Мы используем файлы cookie.
Продолжая использовать сайт, вы даете свое согласие на работу с этими файлами.
Biology-related lists
List of human transcription factors
Другие языки:

    List of human transcription factors

    Подписчиков: 0, рейтинг: 0

    This list of manually curated human transcription factors is taken from Lambert, Jolma, Campitelli et al.
    It was assembled by manual curation.
    More detailed information is found in the manuscript and the web site accompanying the paper (Human Transcription Factors)

    List of human transcription factors (1639)

    Gene ID DBD Motif status (Feb 2018)
    (Link to human TFs annotation)    		 IUPAC consensus
    (from selected PWM)
    AC008770.3 ENSG00000267179 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1]
    AC023509.3 ENSG00000267281 bZIP Known motif – from protein with 100% identical DBD – in vitro [2] RTGACGTCAY
    AC092835.1 ENSG00000233757 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [3]
    AC138696.1 ENSG00000264668 C2H2 ZF Known motif – from protein with 100% identical DBD – in vitro [4] RYGGAGAGTTAGC
    ADNP ENSG00000101126 Homeodomain Likely sequence specific TF according to literature or domain structure – No motif [5]
    ADNP2 ENSG00000101544 Homeodomain Likely sequence specific TF according to literature or domain structure – No motif [6]
    AEBP1 ENSG00000106624 Unknown Likely sequence specific TF according to literature or domain structure – No motif [7]
    AEBP2 ENSG00000139154 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [8]
    AHCTF1 ENSG00000153207 AT hook Likely sequence specific TF according to literature or domain structure – No motif [9]
    AHDC1 ENSG00000126705 AT hook Likely sequence specific TF according to literature or domain structure – No motif [10]
    AHR ENSG00000106546 bHLH Known motif – In vivo/Misc source [11] BKNGCGTGHV
    AHRR ENSG00000063438 bHLH Inferred motif from similar protein – In vivo/Misc source [12] BKNGCGTGHV
    AIRE ENSG00000160224 SAND Known motif – In vivo/Misc source [13] HNNGGWWNWDWWGGDBDH
    AKAP8 ENSG00000105127 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [14]
    AKAP8L ENSG00000011243 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [15]
    AKNA ENSG00000106948 AT hook Likely sequence specific TF according to literature or domain structure – No motif [16]
    ALX1 ENSG00000180318 Homeodomain Known motif – High-throughput in vitro [17] TAATYTAATTA
    ALX3 ENSG00000156150 Homeodomain Known motif – High-throughput in vitro [18] TAATTR
    ALX4 ENSG00000052850 Homeodomain Known motif – High-throughput in vitro [19] TAATYNRRTTA
    ANHX ENSG00000227059 Homeodomain Known motif – High-throughput in vitro [20] KTKACAWG
    ANKZF1 ENSG00000163516 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [21]
    AR ENSG00000169083 Nuclear receptor Known motif – High-throughput in vitro [22] RGGWACRHBDYGTWCYH
    ARGFX ENSG00000186103 Homeodomain Known motif – High-throughput in vitro [23] DYTAATTAR
    ARHGAP35 ENSG00000160007 Unknown Likely sequence specific TF according to literature or domain structure – No motif [24]
    ARID2 ENSG00000189079 ARID/BRIGHT; RFX Likely sequence specific TF according to literature or domain structure – No motif [25]
    ARID3A ENSG00000116017 ARID/BRIGHT Known motif – from protein with 100% identical DBD – in vitro [26] DATHAAD
    ARID3B ENSG00000179361 ARID/BRIGHT Inferred motif from similar protein – High-throughput in vitro [27] WWTTAATH
    ARID3C ENSG00000205143 ARID/BRIGHT Inferred motif from similar protein – High-throughput in vitro [28] DATHAAD
    ARID5A ENSG00000196843 ARID/BRIGHT Known motif – from protein with 100% identical DBD – in vitro [29] HAATATTD
    ARID5B ENSG00000150347 ARID/BRIGHT Known motif – from protein with 100% identical DBD – in vitro [30] DATWH
    ARNT ENSG00000143437 bHLH Known motif – from protein with 100% identical DBD – in vitro [31] KCACGTGM
    ARNT2 ENSG00000172379 bHLH Known motif – High-throughput in vitro [32] RDCACGTGM
    ARNTL ENSG00000133794 bHLH Known motif – High-throughput in vitro [33] GTCACGTGAC
    ARNTL2 ENSG00000029153 bHLH Inferred motif from similar protein – High-throughput in vitro [34] CACGTGAY
    ARX ENSG00000004848 Homeodomain Known motif – High-throughput in vitro [35] TAATYNRATTA
    ASCL1 ENSG00000139352 bHLH Known motif – High-throughput in vitro [36] RCASSTGY
    ASCL2 ENSG00000183734 bHLH Known motif – High-throughput in vitro [37] RCAGCTGY
    ASCL3 ENSG00000176009 bHLH Inferred motif from similar protein – High-throughput in vitro [38] RCASSTGY
    ASCL4 ENSG00000187855 bHLH Inferred motif from similar protein – High-throughput in vitro [39] RCASSTGY
    ASCL5 ENSG00000232237 bHLH Inferred motif from similar protein – High-throughput in vitro [40] RCASSTGY
    ASH1L ENSG00000116539 AT hook Likely sequence specific TF according to literature or domain structure – No motif [41]
    ATF1 ENSG00000123268 bZIP Known motif – In vivo/Misc source [42] VTGACGTSAV
    ATF2 ENSG00000115966 bZIP Known motif – High-throughput in vitro [43] VTKACGTMAB
    ATF3 ENSG00000162772 bZIP Known motif – High-throughput in vitro [44] RTGACGTCAY
    ATF4 ENSG00000128272 bZIP Known motif – High-throughput in vitro [45] RKATGACGTCATMY
    ATF5 ENSG00000169136 bZIP Known motif – In vivo/Misc source [46] WAAGGRAGARR
    ATF6 ENSG00000118217 bZIP Known motif – High-throughput in vitro [47] YKRTGACGTGGCA
    ATF6B ENSG00000213676 bZIP Known motif – High-throughput in vitro [48] RTGACGTGGCR
    ATF7 ENSG00000170653 bZIP Known motif – High-throughput in vitro [49] DRTGACGTCAT
    ATMIN ENSG00000166454 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [50]
    ATOH1 ENSG00000172238 bHLH Known motif – High-throughput in vitro [51] RACAGCTGYY
    ATOH7 ENSG00000179774 bHLH Known motif – High-throughput in vitro [52] RVCATATGBT
    ATOH8 ENSG00000168874 bHLH Inferred motif from similar protein – High-throughput in vitro [53] AAWTANNNBRMCATATGKY
    BACH1 ENSG00000156273 bZIP Known motif – In vivo/Misc source [54] RTGACTCAGCANWWH
    BACH2 ENSG00000112182 bZIP Known motif – High-throughput in vitro [55] WDNSATGASTCATGNWW
    BARHL1 ENSG00000125492 Homeodomain Known motif – High-throughput in vitro [56] TAAWYG
    BARHL2 ENSG00000143032 Homeodomain Known motif – High-throughput in vitro [57] TAAWBG
    BARX1 ENSG00000131668 Homeodomain Known motif – High-throughput in vitro [58] TAATBGNWWWTTAATBR
    BARX2 ENSG00000043039 Homeodomain Known motif – High-throughput in vitro [59] TAAYKRTTWW
    BATF ENSG00000156127 bZIP Known motif – High-throughput in vitro [60] VVYGMCAC
    BATF2 ENSG00000168062 bZIP Likely sequence specific TF according to literature or domain structure – No motif [61]
    BATF3 ENSG00000123685 bZIP Known motif – High-throughput in vitro [62] VTGACGTCAYV
    BAZ2A ENSG00000076108 MBD; AT hook Likely sequence specific TF according to literature or domain structure – No motif [63]
    BAZ2B ENSG00000123636 MBD Likely sequence specific TF according to literature or domain structure – No motif [64]
    BBX ENSG00000114439 HMG/Sox Known motif – High-throughput in vitro [65] TGAWCDNYGWTCA
    BCL11A ENSG00000119866 C2H2 ZF Known motif – In vivo/Misc source [66] DDRRGGAASTGARAV
    BCL11B ENSG00000127152 C2H2 ZF Known motif – High-throughput in vitro [67] GTGAACGBNDNNVCTACAC
    BCL6 ENSG00000113916 C2H2 ZF Known motif – High-throughput in vitro [68] YGCTTTCKAGGAAH
    BCL6B ENSG00000161940 C2H2 ZF Known motif – High-throughput in vitro [69] GCTTTCKAGGAAH
    BHLHA15 ENSG00000180535 bHLH Known motif – High-throughput in vitro [70] VCATATGB
    BHLHA9 ENSG00000205899 bHLH Likely sequence specific TF according to literature or domain structure – No motif [71]
    BHLHE22 ENSG00000180828 bHLH Known motif – High-throughput in vitro [72] AVCATATGBT
    BHLHE23 ENSG00000125533 bHLH Known motif – High-throughput in vitro [73] AVCATATGBY
    BHLHE40 ENSG00000134107 bHLH Known motif – High-throughput in vitro [74] DKCACGTGM
    BHLHE41 ENSG00000123095 bHLH Known motif – High-throughput in vitro [75] RKCACGTGAY
    BNC1 ENSG00000169594 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [76] CCRCCWTCA
    BNC2 ENSG00000173068 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [77] CCRCCWTCA
    BORCS8-MEF2B ENSG00000064489 MADS box Known motif – from protein with 100% identical DBD – in vitro [78] CCDWWWHNRG
    BPTF ENSG00000171634 Unknown Known motif – In vivo/Misc source [79] KKKNTTGTKKNV
    BRF2 ENSG00000104221 Unknown Likely sequence specific TF according to literature or domain structure – No motif [80]
    BSX ENSG00000188909 Homeodomain Known motif – High-throughput in vitro [81] TAATBR
    C11orf95 ENSG00000188070 BED ZF Likely sequence specific TF according to literature or domain structure – No motif [82]
    CAMTA1 ENSG00000171735 CG-1 Likely sequence specific TF according to literature or domain structure – No motif [83]
    CAMTA2 ENSG00000108509 CG-1 Likely sequence specific TF according to literature or domain structure – No motif [84]
    CARF ENSG00000138380 Unknown Known motif – In vivo/Misc source [85] GCCTCGTTYTSR
    CASZ1 ENSG00000130940 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [86]
    CBX2 ENSG00000173894 AT hook Likely sequence specific TF according to literature or domain structure – No motif [87]
    CC2D1A ENSG00000132024 Unknown Likely sequence specific TF according to literature or domain structure – No motif [88]
    CCDC169-SOHLH2 ENSG00000250709 bHLH Known motif – from protein with 100% identical DBD – in vitro [89] BCACGTGC
    CCDC17 ENSG00000159588 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [90]
    CDC5L ENSG00000096401 Myb/SANT Known motif – In vivo/Misc source [91] VBGWKDTAAYRWAWB
    CDX1 ENSG00000113722 Homeodomain Known motif – High-throughput in vitro [92] TTTATKRB
    CDX2 ENSG00000165556 Homeodomain Known motif – High-throughput in vitro [93] DWWATKRB
    CDX4 ENSG00000131264 Homeodomain Known motif – High-throughput in vitro [94] VKTTTATKRCH
    CEBPA ENSG00000245848 bZIP Known motif – from protein with 100% identical DBD – in vitro [95] TTGCGHAA
    CEBPB ENSG00000172216 bZIP Known motif – High-throughput in vitro [96] VTTRCGCAAY
    CEBPD ENSG00000221869 bZIP Known motif – High-throughput in vitro [97] VTTRCGCAAY
    CEBPE ENSG00000092067 bZIP Known motif – High-throughput in vitro [98] VTTRCGCAAY
    CEBPG ENSG00000153879 bZIP Known motif – High-throughput in vitro [99] RTTRCGCAAY
    CEBPZ ENSG00000115816 Unknown Known motif – In vivo/Misc source [100] DSTSATTGGCT
    CENPA ENSG00000115163 Unknown Likely sequence specific TF according to literature or domain structure – No motif [101]
    CENPB ENSG00000125817 CENPB Known motif – High-throughput in vitro [102] TWCGYNNNAHRCGGG
    CENPBD1 ENSG00000177946 CENPB Known motif – High-throughput in vitro [103] WNYGWAD
    CENPS ENSG00000175279 Unknown Likely sequence specific TF according to literature or domain structure – No motif [104]
    CENPT ENSG00000102901 Unknown Likely sequence specific TF according to literature or domain structure – No motif [105]
    CENPX ENSG00000169689 Unknown Likely sequence specific TF according to literature or domain structure – No motif [106]
    CGGBP1 ENSG00000163320 Unknown Likely sequence specific TF according to literature or domain structure – No motif [107]
    CHAMP1 ENSG00000198824 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [108]
    CHCHD3 ENSG00000106554 Unknown Likely sequence specific TF according to literature or domain structure – No motif [109]
    CIC ENSG00000079432 HMG/Sox Known motif – from protein with 100% identical DBD – in vitro [110] VTCAGCA
    CLOCK ENSG00000134852 bHLH Known motif – High-throughput in vitro [111] DACACGTGYH
    CPEB1 ENSG00000214575 Unknown Known motif – High-throughput in vitro [112] HTTTTATH
    CPXCR1 ENSG00000147183 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [113]
    CREB1 ENSG00000118260 bZIP Known motif – High-throughput in vitro [114] VTKACGTMA
    CREB3 ENSG00000107175 bZIP Known motif – High-throughput in vitro [115] RTGACGTGKH
    CREB3L1 ENSG00000157613 bZIP Known motif – High-throughput in vitro [116] TGCCACGTGGCR
    CREB3L2 ENSG00000182158 bZIP Known motif – from protein with 100% identical DBD – in vitro [117] HCACGTGKM
    CREB3L3 ENSG00000060566 bZIP Likely sequence specific TF according to literature or domain structure – No motif [118]
    CREB3L4 ENSG00000143578 bZIP Known motif – High-throughput in vitro [119] VTGACGTGGM
    CREB5 ENSG00000146592 bZIP Known motif – High-throughput in vitro [120] VTKACRTMAB
    CREBL2 ENSG00000111269 bZIP Inferred motif from similar protein – High-throughput in vitro [121] ATKACGTMAY
    CREBZF ENSG00000137504 bZIP Inferred motif from similar protein – High-throughput in vitro [122] WWACGTWD
    CREM ENSG00000095794 bZIP Known motif – High-throughput in vitro [123] VVTBACGTVAB
    CRX ENSG00000105392 Homeodomain Known motif – High-throughput in vitro [124] TAATCC
    CSRNP1 ENSG00000144655 Unknown Likely sequence specific TF according to literature or domain structure – No motif [125]
    CSRNP2 ENSG00000110925 Unknown Likely sequence specific TF according to literature or domain structure – No motif [126]
    CSRNP3 ENSG00000178662 Unknown Likely sequence specific TF according to literature or domain structure – No motif [127]
    CTCF ENSG00000102974 C2H2 ZF Known motif – High-throughput in vitro [128] CCDSBAGGKGGCGCB
    CTCFL ENSG00000124092 C2H2 ZF Known motif – In vivo/Misc source [129] CCNSYAGGGGGCGCY
    CUX1 ENSG00000257923 CUT; Homeodomain Known motif – High-throughput in vitro [130] ATYGATHA
    CUX2 ENSG00000111249 CUT; Homeodomain Known motif – High-throughput in vitro [131] DDATYGATYA
    CXXC1 ENSG00000154832 CxxC Known motif – High-throughput in vitro [132] BCG
    CXXC4 ENSG00000168772 CxxC Likely sequence specific TF according to literature or domain structure – No motif [133]
    CXXC5 ENSG00000171604 CxxC Known motif – High-throughput in vitro [134] DCK
    DACH1 ENSG00000276644 Unknown Likely sequence specific TF according to literature or domain structure – No motif [135]
    DACH2 ENSG00000126733 Unknown Likely sequence specific TF according to literature or domain structure – No motif [136]
    DBP ENSG00000105516 bZIP Known motif – High-throughput in vitro [137] RTTAYRTAAB
    DBX1 ENSG00000109851 Homeodomain Inferred motif from similar protein – High-throughput in vitro [138] WTTAATTA
    DBX2 ENSG00000185610 Homeodomain Inferred motif from similar protein – High-throughput in vitro [139] AH
    DDIT3 ENSG00000175197 bZIP Known motif – In vivo/Misc source [140] RVVKATTGCANNB
    DEAF1 ENSG00000177030 SAND Inferred motif from similar protein – In vivo/Misc source [141] VCRBNYYCGKGDRYTTCCGDVDNNB
    DLX1 ENSG00000144355 Homeodomain Known motif – High-throughput in vitro [142] TAATTR
    DLX2 ENSG00000115844 Homeodomain Known motif – High-throughput in vitro [143] TAATTR
    DLX3 ENSG00000064195 Homeodomain Known motif – High-throughput in vitro [144] TAATTR
    DLX4 ENSG00000108813 Homeodomain Known motif – High-throughput in vitro [145] TAATTR
    DLX5 ENSG00000105880 Homeodomain Known motif – High-throughput in vitro [146] TAATTR
    DLX6 ENSG00000006377 Homeodomain Known motif – High-throughput in vitro [147] TAATTR
    DMBX1 ENSG00000197587 Homeodomain Known motif – High-throughput in vitro [148] HTAATCCB
    DMRT1 ENSG00000137090 DM Known motif – High-throughput in vitro [149] GHWACWH
    DMRT2 ENSG00000173253 DM Known motif – High-throughput in vitro [150] DATAMATT
    DMRT3 ENSG00000064218 DM Known motif – High-throughput in vitro [151] DWWTTGWTACAWT
    DMRTA1 ENSG00000176399 DM Known motif – High-throughput in vitro [152] DDWTGHTACAW
    DMRTA2 ENSG00000142700 DM Known motif – High-throughput in vitro [153] DHBGHWACADB
    DMRTB1 ENSG00000143006 DM Likely sequence specific TF according to literature or domain structure – No motif [154]
    DMRTC2 ENSG00000142025 DM Known motif – High-throughput in vitro [155] WWTTGHTACAW
    DMTF1 ENSG00000135164 Myb/SANT Likely sequence specific TF according to literature or domain structure – No motif [156]
    DNMT1 ENSG00000130816 CxxC Known motif – High-throughput in vitro [157] CGG
    DNTTIP1 ENSG00000101457 AT hook Likely sequence specific TF according to literature or domain structure – No motif [158]
    DOT1L ENSG00000104885 AT hook Likely sequence specific TF according to literature or domain structure – No motif [159]
    DPF1 ENSG00000011332 C2H2 ZF Known motif – High-throughput in vitro [160] KMTATAGGBG
    DPF3 ENSG00000205683 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [161] KMTATAGGBG
    DPRX ENSG00000204595 Homeodomain Known motif – High-throughput in vitro [162] RGMTAATCY
    DR1 ENSG00000117505 Unknown Likely sequence specific TF according to literature or domain structure – No motif [163]
    DRAP1 ENSG00000175550 Unknown Likely sequence specific TF according to literature or domain structure – No motif [164]
    DRGX ENSG00000165606 Homeodomain Known motif – High-throughput in vitro [165] TAATYNAATTA
    DUX1 DUX1_HUMAN Homeodomain Known motif – In vivo/Misc source [166] ATAATCTGATTAT
    DUX3 DUX3_HUMAN Homeodomain Known motif – In vivo/Misc source [167] TTAATTAAATTAA
    DUX4 ENSG00000260596 Homeodomain Known motif – In vivo/Misc source [168] TGATTRRRTTA
    DUXA ENSG00000258873 Homeodomain Known motif – High-throughput in vitro [169] TGATTRVRTYD
    DZIP1 ENSG00000134874 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [170]
    E2F1 ENSG00000101412 E2F Known motif – High-throughput in vitro [171] WTTGGCGCCHWW
    E2F2 ENSG00000007968 E2F Known motif – High-throughput in vitro [172] WDWWGGCGCCHWWH
    E2F3 ENSG00000112242 E2F Known motif – High-throughput in vitro [173] TTTTGGCGCCMTTTTY
    E2F4 ENSG00000205250 E2F Known motif – High-throughput in vitro [174] TTTGGCGCCAAA
    E2F5 ENSG00000133740 E2F Known motif – In vivo/Misc source [175] TTTSGCGC
    E2F6 ENSG00000169016 E2F Known motif – In vivo/Misc source [176] DGGMGGGARV
    E2F7 ENSG00000165891 E2F Known motif – High-throughput in vitro [177] WTTTGGCGGGAAAH
    E2F8 ENSG00000129173 E2F Known motif – High-throughput in vitro [178] TTTGGCGGGAAA
    E4F1 ENSG00000167967 C2H2 ZF Known motif – In vivo/Misc source [179] RTGACGTARS
    EBF1 ENSG00000164330 EBF1 Known motif – High-throughput in vitro [180] ANTCCCHWGGGAHH
    EBF2 ENSG00000221818 EBF1 Known motif – In vivo/Misc source [181] VTGMAACCCCCWWTHVK
    EBF3 ENSG00000108001 EBF1 Known motif – In vivo/Misc source [182] BTCCCYWGRGD
    EBF4 ENSG00000088881 EBF1 Known motif – In vivo/Misc source [183] CGSATAACCMTTGTTATCAB
    EEA1 ENSG00000102189 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [184]
    EGR1 ENSG00000120738 C2H2 ZF Known motif – High-throughput in vitro [185] MCGCCCMCGCA
    EGR2 ENSG00000122877 C2H2 ZF Known motif – High-throughput in vitro [186] MCGCCCACGCD
    EGR3 ENSG00000179388 C2H2 ZF Known motif – High-throughput in vitro [187] HMCGCCCMCGCAH
    EGR4 ENSG00000135625 C2H2 ZF Known motif – High-throughput in vitro [188] HMCGCCCACGCAH
    EHF ENSG00000135373 Ets Known motif – High-throughput in vitro [189] ACCCGGAAGTD
    ELF1 ENSG00000120690 Ets Known motif – High-throughput in vitro [190] WHSCGGAAGY
    ELF2 ENSG00000109381 Ets Known motif – High-throughput in vitro [191] AMCCGGAAGTV
    ELF3 ENSG00000163435 Ets; AT hook Known motif – High-throughput in vitro [192] WACCCGGAAGTR
    ELF4 ENSG00000102034 Ets Known motif – High-throughput in vitro [193] ABSCGGAAGTR
    ELF5 ENSG00000135374 Ets Known motif – High-throughput in vitro [194] WNVMGGAARY
    ELK1 ENSG00000126767 Ets Known motif – High-throughput in vitro [195] RCCGGAAGT
    ELK3 ENSG00000111145 Ets Known motif – High-throughput in vitro [196] RCCGGAAGT
    ELK4 ENSG00000158711 Ets Known motif – High-throughput in vitro [197] ACCGGAARY
    EMX1 ENSG00000135638 Homeodomain Known motif – High-throughput in vitro [198] BTAATTR
    EMX2 ENSG00000170370 Homeodomain Known motif – High-throughput in vitro [199] BTAATTA
    EN1 ENSG00000163064 Homeodomain Known motif – High-throughput in vitro [200] TAATTRVB
    EN2 ENSG00000164778 Homeodomain Known motif – High-throughput in vitro [201] TAATTR
    EOMES ENSG00000163508 T-box Known motif – High-throughput in vitro [202] WTCACACCTH
    EPAS1 ENSG00000116016 bHLH Known motif – In vivo/Misc source [203] VDACGTGHH
    ERF ENSG00000105722 Ets Known motif – High-throughput in vitro [204] ACCGGAARTV
    ERG ENSG00000157554 Ets Known motif – High-throughput in vitro [205] ACCGGAARY
    ESR1 ENSG00000091831 Nuclear receptor Known motif – High-throughput in vitro [206] AGGTCAYSRTGACCT
    ESR2 ENSG00000140009 Nuclear receptor Known motif – from protein with 100% identical DBD – in vitro [207] RGGTCAH
    ESRRA ENSG00000173153 Nuclear receptor Known motif – High-throughput in vitro [208] SAAGGTCA
    ESRRB ENSG00000119715 Nuclear receptor Known motif – High-throughput in vitro [209] TCAAGGTCAWH
    ESRRG ENSG00000196482 Nuclear receptor Known motif – High-throughput in vitro [210] SAAGGTCR
    ESX1 ENSG00000123576 Homeodomain Known motif – High-throughput in vitro [211] TAATTR
    ETS1 ENSG00000134954 Ets Known motif – High-throughput in vitro [212] RCCGGAWRYRYWTCCGSH
    ETS2 ENSG00000157557 Ets Known motif – High-throughput in vitro [213] ACCGGAWGYRCWTCCGGT
    ETV1 ENSG00000006468 Ets Known motif – High-throughput in vitro [214] RCCGGAWRY
    ETV2 ENSG00000105672 Ets Known motif – High-throughput in vitro [215] DACCGGAARYD
    ETV3 ENSG00000117036 Ets Known motif – High-throughput in vitro [216] AHCGGAWWTCCGNT
    ETV3L ENSG00000253831 Ets Known motif – from protein with 100% identical DBD – in vitro [217] VGGAWR
    ETV4 ENSG00000175832 Ets Known motif – High-throughput in vitro [218] RCCGGAWGY
    ETV5 ENSG00000244405 Ets Known motif – High-throughput in vitro [219] DVCGGAWRY
    ETV6 ENSG00000139083 Ets Known motif – High-throughput in vitro [220] SCGGAASCGGAAGYR
    ETV7 ENSG00000010030 Ets Known motif – High-throughput in vitro [221] VVGGAAGYRCTTCCBB
    EVX1 ENSG00000106038 Homeodomain Known motif – High-throughput in vitro [222] TAATBRB
    EVX2 ENSG00000174279 Homeodomain Known motif – High-throughput in vitro [223] TAATBRB
    FAM170A ENSG00000164334 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [224]
    FAM200B ENSG00000237765 BED ZF Likely sequence specific TF according to literature or domain structure – No motif [225]
    FBXL19 ENSG00000099364 CxxC Likely sequence specific TF according to literature or domain structure – No motif [226]
    FERD3L ENSG00000146618 bHLH Known motif – High-throughput in vitro [227] GYRMCAGCTGTBRC
    FEV ENSG00000163497 Ets Known motif – High-throughput in vitro [228] ACCGGAART
    FEZF1 ENSG00000128610 C2H2 ZF Known motif – High-throughput in vitro [229] AAAARRRCAV
    FEZF2 ENSG00000153266 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [230] AAAWGAGCAATCA
    FIGLA ENSG00000183733 bHLH Known motif – High-throughput in vitro [231] MCAGGTGKD
    FIZ1 ENSG00000179943 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [232]
    FLI1 ENSG00000151702 Ets Known motif – High-throughput in vitro [233] RCCGGAWRY
    FLYWCH1 ENSG00000059122 FLYWCH Likely sequence specific TF according to literature or domain structure – No motif [234]
    FOS ENSG00000170345 bZIP Known motif – High-throughput in vitro [235] BRTGACGTCAYV
    FOSB ENSG00000125740 bZIP Known motif – High-throughput in vitro [236] RTGACGTCAY
    FOSL1 ENSG00000175592 bZIP Known motif – High-throughput in vitro [237] DRTGAYRCR
    FOSL2 ENSG00000075426 bZIP Known motif – High-throughput in vitro [238] TKANTCAYNRTGACGTCAY
    FOXA1 ENSG00000129514 Forkhead Known motif – High-throughput in vitro [239] BVYTAWGTAAACAAW
    FOXA2 ENSG00000125798 Forkhead Known motif – High-throughput in vitro [240] HNNGTMAATATTKRYNBD
    FOXA3 ENSG00000170608 Forkhead Known motif – High-throughput in vitro [241] BVYTAWGTAAACAAA
    FOXB1 ENSG00000171956 Forkhead Known motif – High-throughput in vitro [242] WRWGTMAATATTKACWYW
    FOXB2 ENSG00000204612 Forkhead Inferred motif from similar protein – High-throughput in vitro [243] HWRWGYMAATATTKRCHYW
    FOXC1 ENSG00000054598 Forkhead Known motif – High-throughput in vitro [244] WRWRTMAAYAW
    FOXC2 ENSG00000176692 Forkhead Known motif – High-throughput in vitro [245] WAHRTMAAYAWW
    FOXD1 ENSG00000251493 Forkhead Known motif – from protein with 100% identical DBD – in vitro [246] HWASAATAAYAWW
    FOXD2 ENSG00000186564 Forkhead Known motif – High-throughput in vitro [247] RTAAAYA
    FOXD3 ENSG00000187140 Forkhead Known motif – High-throughput in vitro [248] RTAAAYA
    FOXD4 ENSG00000170122 Forkhead Inferred motif from similar protein – In vivo/Misc source [249] GTTAAAGCVAKTTTAA
    FOXD4L1 ENSG00000184492 Forkhead Inferred motif from similar protein – In vivo/Misc source [250] GTTAAAGCVAKTTTAA
    FOXD4L3 ENSG00000187559 Forkhead Inferred motif from similar protein – In vivo/Misc source [251] MGGTAAATCMAGGGWWT
    FOXD4L4 ENSG00000184659 Forkhead Known motif – In vivo/Misc source [252] MGGTAAATCMAGGGWWT
    FOXD4L5 ENSG00000204779 Forkhead Inferred motif from similar protein – In vivo/Misc source [253] MGGTAAATCMAGGGWWT
    FOXD4L6 ENSG00000273514 Forkhead Inferred motif from similar protein – In vivo/Misc source [254] MGGTAAATCMAGGGWWT
    FOXE1 ENSG00000178919 Forkhead Known motif – High-throughput in vitro [255] BVYTAWRYAAACAD
    FOXE3 ENSG00000186790 Forkhead Inferred motif from similar protein – High-throughput in vitro [256] BVYTAWRYAAACAD
    FOXF1 ENSG00000103241 Forkhead Known motif – In vivo/Misc source [257] YRHATAAACAHNB
    FOXF2 ENSG00000137273 Forkhead Known motif – In vivo/Misc source [258] BNHNBRTAAACAHNV
    FOXG1 ENSG00000176165 Forkhead Known motif – High-throughput in vitro [259] RTAAACAH
    FOXH1 ENSG00000160973 Forkhead Known motif – In vivo/Misc source [260] BNSAATMCACA
    FOXI1 ENSG00000168269 Forkhead Known motif – High-throughput in vitro [261] RTMAACA
    FOXI2 ENSG00000186766 Forkhead Inferred motif from similar protein – High-throughput in vitro [262] RTMAACA
    FOXI3 ENSG00000214336 Forkhead Inferred motif from similar protein – High-throughput in vitro [263] RTMAACA
    FOXJ1 ENSG00000129654 Forkhead Known motif – from protein with 100% identical DBD – in vitro [264] HAAACAAA
    FOXJ2 ENSG00000065970 Forkhead Known motif – High-throughput in vitro [265] GTAAACAWMAACA
    FOXJ3 ENSG00000198815 Forkhead Known motif – High-throughput in vitro [266] RTAAACAW
    FOXK1 ENSG00000164916 Forkhead Known motif – High-throughput in vitro [267] RWMMAYA
    FOXK2 ENSG00000141568 Forkhead Inferred motif from similar protein – High-throughput in vitro [268] RWMAACAA
    FOXL1 ENSG00000176678 Forkhead Known motif – High-throughput in vitro [269] RTAAACA
    FOXL2 ENSG00000183770 Forkhead Known motif – High-throughput in vitro [270] VBGHMAACAH
    FOXM1 ENSG00000111206 Forkhead Known motif – from protein with 100% identical DBD – in vitro [271] RWHR
    FOXN1 ENSG00000109101 Forkhead Known motif – In vivo/Misc source [272] WVBSACGCB
    FOXN2 ENSG00000170802 Forkhead Known motif – High-throughput in vitro [273] GCGTSNNNNNSACGC
    FOXN3 ENSG00000053254 Forkhead Known motif – High-throughput in vitro [274] GTAAACAA
    FOXN4 ENSG00000139445 Forkhead Known motif – In vivo/Misc source [275] WHNWRRNGACGCYATNHM
    FOXO1 ENSG00000150907 Forkhead Known motif – High-throughput in vitro [276] RTAAACATGTTTAC
    FOXO3 ENSG00000118689 Forkhead Known motif – High-throughput in vitro [277] GTAAACAW
    FOXO4 ENSG00000184481 Forkhead Known motif – High-throughput in vitro [278] GTAAACA
    FOXO6 ENSG00000204060 Forkhead Known motif – High-throughput in vitro [279] GTAAACATGTTTAC
    FOXP1 ENSG00000114861 Forkhead Known motif – High-throughput in vitro [280] TGTTTRYNRTNNNNNNBNAYRVWMAACA
    FOXP2 ENSG00000128573 Forkhead Known motif – High-throughput in vitro [281] RTAAAYAW
    FOXP3 ENSG00000049768 Forkhead Known motif – High-throughput in vitro [282] RTAAACA
    FOXP4 ENSG00000137166 Forkhead Inferred motif from similar protein – High-throughput in vitro [283] RTMAAYA
    FOXQ1 ENSG00000164379 Forkhead Known motif – High-throughput in vitro [284] YWRHRTAAACWD
    FOXR1 ENSG00000176302 Forkhead Known motif – High-throughput in vitro [285] CAADY
    FOXR2 ENSG00000189299 Forkhead Known motif – High-throughput in vitro [286] RYRTAWACATAAAWRHH
    FOXS1 ENSG00000179772 Forkhead Inferred motif from similar protein – High-throughput in vitro [287] HNNRHMAAYA
    GABPA ENSG00000154727 Ets Known motif – High-throughput in vitro [288] RSCGGAWRY
    GATA1 ENSG00000102145 GATA Known motif – High-throughput in vitro [289] GATWASMH
    GATA2 ENSG00000179348 GATA Known motif – High-throughput in vitro [290] VHGATAHSV
    GATA3 ENSG00000107485 GATA Known motif – High-throughput in vitro [291] HGATAAVV
    GATA4 ENSG00000136574 GATA Known motif – High-throughput in vitro [292] HGATAAVV
    GATA5 ENSG00000130700 GATA Known motif – High-throughput in vitro [293] HGATAASV
    GATA6 ENSG00000141448 GATA Known motif – High-throughput in vitro [294] HGATAABVATCD
    GATAD2A ENSG00000167491 GATA Likely sequence specific TF according to literature or domain structure – No motif [295]
    GATAD2B ENSG00000143614 GATA Likely sequence specific TF according to literature or domain structure – No motif [296]
    GBX1 ENSG00000164900 Homeodomain Known motif – High-throughput in vitro [297] BTAATTRSB
    GBX2 ENSG00000168505 Homeodomain Known motif – High-throughput in vitro [298] TAATTR
    GCM1 ENSG00000137270 GCM Known motif – High-throughput in vitro [299] BATGCGGGTRS
    GCM2 ENSG00000124827 GCM Known motif – High-throughput in vitro [300] HRCCCGCAT
    GFI1 ENSG00000162676 C2H2 ZF Known motif – High-throughput in vitro [301] BMAATCACDGCNHBBCACTM
    GFI1B ENSG00000165702 C2H2 ZF Known motif – High-throughput in vitro [302] MAATCASDGCNNBBCACT
    GLI1 ENSG00000111087 C2H2 ZF Known motif – In vivo/Misc source [303] SMCCHCCCA
    GLI2 ENSG00000074047 C2H2 ZF Known motif – High-throughput in vitro [304] GMCCACMCANVNHB
    GLI3 ENSG00000106571 C2H2 ZF Known motif – High-throughput in vitro [305] VGACCACCCACVNHG
    GLI4 ENSG00000250571 C2H2 ZF Known motif – In vivo/Misc source [306] RRGCCTTGAATGCCANGNYMA
    GLIS1 ENSG00000174332 C2H2 ZF Known motif – High-throughput in vitro [307] MGACCCCCCACGWHG
    GLIS2 ENSG00000126603 C2H2 ZF Known motif – High-throughput in vitro [308] KACCCCCCRCRDHG
    GLIS3 ENSG00000107249 C2H2 ZF Known motif – High-throughput in vitro [309] KACCCCCCACRAAG
    GLMP ENSG00000198715 Unknown Likely sequence specific TF according to literature or domain structure – No motif [310]
    GLYR1 ENSG00000140632 AT hook Likely sequence specific TF according to literature or domain structure – No motif [311]
    GMEB1 ENSG00000162419 SAND Known motif – High-throughput in vitro [312] KTACGTAMNKTACGTMM
    GMEB2 ENSG00000101216 SAND Known motif – High-throughput in vitro [313] YBACGYAM
    GPBP1 ENSG00000062194 Unknown Likely sequence specific TF according to literature or domain structure – No motif [314]
    GPBP1L1 ENSG00000159592 Unknown Likely sequence specific TF according to literature or domain structure – No motif [315]
    GRHL1 ENSG00000134317 Grainyhead Known motif – High-throughput in vitro [316] DAACCGGTTH
    GRHL2 ENSG00000083307 Grainyhead Known motif – In vivo/Misc source [317] RAACHDGHHHDDCHDGTTY
    GRHL3 ENSG00000158055 Grainyhead Likely sequence specific TF according to literature or domain structure – No motif [318]
    GSC ENSG00000133937 Homeodomain Known motif – High-throughput in vitro [319] HTAATCC
    GSC2 ENSG00000063515 Homeodomain Known motif – High-throughput in vitro [320] HTAATCCBH
    GSX1 ENSG00000169840 Homeodomain Known motif – High-throughput in vitro [321] TAATKR
    GSX2 ENSG00000180613 Homeodomain Known motif – High-throughput in vitro [322] TAATKR
    GTF2B ENSG00000137947 Unknown Known motif – In vivo/Misc source [323] STYWYAKASTS
    GTF2I ENSG00000263001 GTF2I-like Known motif – In vivo/Misc source [324] VAGVDVKTSH
    GTF2IRD1 ENSG00000006704 GTF2I-like Known motif – In vivo/Misc source [325] TRTCGCWG
    GTF2IRD2 ENSG00000196275 GTF2I-like Likely sequence specific TF according to literature or domain structure – No motif [326]
    GTF2IRD2B ENSG00000174428 GTF2I-like Likely sequence specific TF according to literature or domain structure – No motif [327]
    GTF3A ENSG00000122034 C2H2 ZF Known motif – High-throughput in vitro [328] GGATGGGAG
    GZF1 ENSG00000125812 C2H2 ZF Known motif – In vivo/Misc source [329] TATAKAVGCGCA
    HAND1 ENSG00000113196 bHLH Known motif – In vivo/Misc source [330] DBRTCTGGHWDH
    HAND2 ENSG00000164107 bHLH Known motif – High-throughput in vitro [331] HVCAGGTGTK
    HBP1 ENSG00000105856 HMG/Sox Known motif – from protein with 100% identical DBD – in vitro [332] DD
    HDX ENSG00000165259 Homeodomain Known motif – High-throughput in vitro [333] H
    HELT ENSG00000187821 bHLH Inferred motif from similar protein – High-throughput in vitro [334] BBCACGTGY
    HES1 ENSG00000114315 bHLH Known motif – High-throughput in vitro [335] KDCRCGTGBB
    HES2 ENSG00000069812 bHLH Known motif – High-throughput in vitro [336] VRCACGTGCC
    HES3 ENSG00000173673 bHLH Inferred motif from similar protein – High-throughput in vitro [337] KDCRCGTGBB
    HES4 ENSG00000188290 bHLH Inferred motif from similar protein – High-throughput in vitro [338] KDCRCGTGBB
    HES5 ENSG00000197921 bHLH Known motif – High-throughput in vitro [339] HGGCACGTGYCR
    HES6 ENSG00000144485 bHLH Known motif – High-throughput in vitro [340] DACACGTGCC
    HES7 ENSG00000179111 bHLH Known motif – High-throughput in vitro [341] YGGCACGTGCCR
    HESX1 ENSG00000163666 Homeodomain Known motif – High-throughput in vitro [342] HTAATTRVH
    HEY1 ENSG00000164683 bHLH Known motif – High-throughput in vitro [343] BBCRCGYGY
    HEY2 ENSG00000135547 bHLH Known motif – High-throughput in vitro [344] BCACGTGB
    HEYL ENSG00000163909 bHLH Inferred motif from similar protein – High-throughput in vitro [345] BCACGTGB
    HHEX ENSG00000152804 Homeodomain Inferred motif from similar protein – High-throughput in vitro [346] ATND
    HIC1 ENSG00000177374 C2H2 ZF Known motif – High-throughput in vitro [347] RTGCCMMC
    HIC2 ENSG00000169635 C2H2 ZF Known motif – High-throughput in vitro [348] BKGGCAY
    HIF1A ENSG00000100644 bHLH Known motif – In vivo/Misc source [349] VVNGCACGTMBNS
    HIF3A ENSG00000124440 bHLH Inferred motif from similar protein – In vivo/Misc source [350] RWAWWTMATAWCST
    HINFP ENSG00000172273 C2H2 ZF Known motif – High-throughput in vitro [351] GCGGACGYTRSRRCGTCCGC
    HIVEP1 ENSG00000095951 C2H2 ZF Known motif – In vivo/Misc source [352] KGRRRARTCCCB
    HIVEP2 ENSG00000010818 C2H2 ZF Known motif – In vivo/Misc source [353] KBYDNGGHAABNSS
    HIVEP3 ENSG00000127124 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [354] KBYDNGGHAABNSS
    HKR1 ENSG00000181666 C2H2 ZF Known motif – High-throughput in vitro [355] VBKVRVNRDGGAGGRBVNVR
    HLF ENSG00000108924 bZIP Known motif – High-throughput in vitro [356] VTTAYRTAAY
    HLX ENSG00000136630 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [357] AWND
    HMBOX1 ENSG00000147421 Homeodomain Known motif – High-throughput in vitro [358] VYTAGTTAMV
    HMG20A ENSG00000140382 HMG/Sox Likely sequence specific TF according to literature or domain structure – No motif [359]
    HMG20B ENSG00000064961 HMG/Sox Inferred motif from similar protein – High-throughput in vitro [360] WDWATAAT
    HMGA1 ENSG00000137309 AT hook Known motif – In vivo/Misc source [361] WATTWW
    HMGA2 ENSG00000149948 AT hook Known motif – In vivo/Misc source [362] ATATTSSSSDWWAWT
    HMGN3 ENSG00000118418 HMG/Sox Likely sequence specific TF according to literature or domain structure – No motif [363]
    HMX1 ENSG00000215612 Homeodomain Known motif – High-throughput in vitro [364] TTAAKTGNY
    HMX2 ENSG00000188816 Homeodomain Known motif – High-throughput in vitro [365] TTAAKTG
    HMX3 ENSG00000188620 Homeodomain Known motif – High-throughput in vitro [366] TAAKTG
    HNF1A ENSG00000135100 Homeodomain Known motif – High-throughput in vitro [367] GTTAATNATTAAY
    HNF1B ENSG00000275410 Homeodomain Known motif – High-throughput in vitro [368] GTTAATNATTAAY
    HNF4A ENSG00000101076 Nuclear receptor Known motif – High-throughput in vitro [369] VRGGTCAAAGTCCA
    HNF4G ENSG00000164749 Nuclear receptor Known motif – In vivo/Misc source [370] GDNCAAAGKYCA
    HOMEZ ENSG00000215271 Homeodomain Known motif – High-throughput in vitro [371] WWWAATCGTTTW
    HOXA1 ENSG00000105991 Homeodomain Known motif – High-throughput in vitro [372] TAATTR
    HOXA10 ENSG00000253293 Homeodomain Known motif – High-throughput in vitro [373] TTWAYGAY
    HOXA11 ENSG00000005073 Homeodomain Known motif – High-throughput in vitro [374] DWTTTACGACB
    HOXA13 ENSG00000106031 Homeodomain Known motif – High-throughput in vitro [375] DTTTTATKRS
    HOXA2 ENSG00000105996 Homeodomain Known motif – High-throughput in vitro [376] BTAATKR
    HOXA3 ENSG00000105997 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [377] TAATKR
    HOXA4 ENSG00000197576 Homeodomain Known motif – High-throughput in vitro [378] TAATKRY
    HOXA5 ENSG00000106004 Homeodomain Known motif – High-throughput in vitro [379] STAATKRS
    HOXA6 ENSG00000106006 Homeodomain Known motif – High-throughput in vitro [380] TAATKRV
    HOXA7 ENSG00000122592 Homeodomain Known motif – High-throughput in vitro [381] TAATKRV
    HOXA9 ENSG00000078399 Homeodomain Known motif – High-throughput in vitro [382] DTTWAYGAY
    HOXB1 ENSG00000120094 Homeodomain Known motif – High-throughput in vitro [383] STAATTA
    HOXB13 ENSG00000159184 Homeodomain Known motif – High-throughput in vitro [384] TTWAYDD
    HOXB2 ENSG00000173917 Homeodomain Known motif – High-throughput in vitro [385] TAATKR
    HOXB3 ENSG00000120093 Homeodomain Known motif – High-throughput in vitro [386] BTAATKR
    HOXB4 ENSG00000182742 Homeodomain Known motif – High-throughput in vitro [387] YTAATKAY
    HOXB5 ENSG00000120075 Homeodomain Known motif – High-throughput in vitro [388] TAATKRV
    HOXB6 ENSG00000108511 Homeodomain Known motif – High-throughput in vitro [389] TAATKRY
    HOXB7 ENSG00000260027 Homeodomain Known motif – High-throughput in vitro [390] BTAATKRV
    HOXB8 ENSG00000120068 Homeodomain Known motif – High-throughput in vitro [391] TAATKRM
    HOXB9 ENSG00000170689 Homeodomain Known motif – High-throughput in vitro [392] WTTTAYGAY
    HOXC10 ENSG00000180818 Homeodomain Known motif – High-throughput in vitro [393] WTTWAYGAB
    HOXC11 ENSG00000123388 Homeodomain Known motif – High-throughput in vitro [394] WTTWAYGAYH
    HOXC12 ENSG00000123407 Homeodomain Known motif – High-throughput in vitro [395] DTTTTACGAYY
    HOXC13 ENSG00000123364 Homeodomain Known motif – High-throughput in vitro [396] CTCGTAAAAH
    HOXC4 ENSG00000198353 Homeodomain Known motif – High-throughput in vitro [397] TAATKR
    HOXC5 ENSG00000172789 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [398] WRATND
    HOXC6 ENSG00000197757 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [399] TTAATTAB
    HOXC8 ENSG00000037965 Homeodomain Known motif – High-throughput in vitro [400] YAATTR
    HOXC9 ENSG00000180806 Homeodomain Known motif – High-throughput in vitro [401] TTTTACGAC
    HOXD1 ENSG00000128645 Homeodomain Known motif – High-throughput in vitro [402] BTAATTAV
    HOXD10 ENSG00000128710 Homeodomain Known motif – High-throughput in vitro [403] DTTTTACGACY
    HOXD11 ENSG00000128713 Homeodomain Known motif – High-throughput in vitro [404] DWTTTACGAY
    HOXD12 ENSG00000170178 Homeodomain Known motif – High-throughput in vitro [405] DTTTACGAY
    HOXD13 ENSG00000128714 Homeodomain Known motif – High-throughput in vitro [406] BCTCGTAAAAH
    HOXD3 ENSG00000128652 Homeodomain Known motif – High-throughput in vitro [407] CTAATTAS
    HOXD4 ENSG00000170166 Homeodomain Known motif – High-throughput in vitro [408] TMATKRV
    HOXD8 ENSG00000175879 Homeodomain Known motif – High-throughput in vitro [409] HWMATTWDB
    HOXD9 ENSG00000128709 Homeodomain Known motif – High-throughput in vitro [410] TTTTATKRC
    HSF1 ENSG00000185122 HSF Known motif – High-throughput in vitro [411] VGAABVTTCBVGAW
    HSF2 ENSG00000025156 HSF Known motif – High-throughput in vitro [412] VGAANNTTCBVGAA
    HSF4 ENSG00000102878 HSF Known motif – High-throughput in vitro [413] GAANNTTCBVGAA
    HSF5 ENSG00000176160 HSF Known motif – High-throughput in vitro [414] RCGTTCTAGAAYGY
    HSFX1 ENSG00000171116 HSF Likely sequence specific TF according to literature or domain structure – No motif [415]
    HSFX2 ENSG00000268738 HSF Likely sequence specific TF according to literature or domain structure – No motif [416]
    HSFY1 ENSG00000172468 HSF Known motif – High-throughput in vitro [417] DTVGAAYGWTTCGAAYGB
    HSFY2 ENSG00000169953 HSF Known motif – High-throughput in vitro [418] DTCGAAHSNWTCGAW
    IKZF1 ENSG00000185811 C2H2 ZF Known motif – In vivo/Misc source [419] BTGGGARD
    IKZF2 ENSG00000030419 C2H2 ZF Known motif – In vivo/Misc source [420] HDWHGGGADD
    IKZF3 ENSG00000161405 C2H2 ZF Known motif – High-throughput in vitro [421] VSNNGGGAA
    IKZF4 ENSG00000123411 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [422] HDWHGGGADD
    IKZF5 ENSG00000095574 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [423] MYYATGCAGRGT
    INSM1 ENSG00000173404 C2H2 ZF Known motif – In vivo/Misc source [424] YRMCCCCWKRCA
    INSM2 ENSG00000168348 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [425]
    IRF1 ENSG00000125347 IRF Known motif – In vivo/Misc source [426] GAAASTGAAASY
    IRF2 ENSG00000168310 IRF Known motif – High-throughput in vitro [427] GAAAVYGAAAS
    IRF3 ENSG00000126456 IRF Known motif – High-throughput in vitro [428] HSGAAAVBGAAACYGAAAC
    IRF4 ENSG00000137265 IRF Known motif – High-throughput in vitro [429] HCGAAACCGAAACYW
    IRF5 ENSG00000128604 IRF Known motif – High-throughput in vitro [430] CGAAACCGAWACH
    IRF6 ENSG00000117595 IRF Known motif – High-throughput in vitro [431] RGTWTCRNNNNNNCGAWACY
    IRF7 ENSG00000185507 IRF Known motif – High-throughput in vitro [432] CGAAAVYGAAANY
    IRF8 ENSG00000140968 IRF Known motif – High-throughput in vitro [433] CGAAACYGAAACY
    IRF9 ENSG00000213928 IRF Known motif – High-throughput in vitro [434] AWCGAAACCGAAACY
    IRX1 ENSG00000170549 Homeodomain Known motif – High-throughput in vitro [435] DDCRHNNNNNNNNDYGHH
    IRX2 ENSG00000170561 Homeodomain Known motif – High-throughput in vitro [436] DTGTYRTGTH
    IRX3 ENSG00000177508 Homeodomain Known motif – High-throughput in vitro [437] DACAHGNWWWWNCDTGTH
    IRX4 ENSG00000113430 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [438] DAMAH
    IRX5 ENSG00000176842 Homeodomain Known motif – High-throughput in vitro [439] DTGTYRTGTH
    IRX6 ENSG00000159387 Homeodomain Inferred motif from similar protein – High-throughput in vitro [440] DAMAH
    ISL1 ENSG00000016082 Homeodomain Known motif – High-throughput in vitro [441] BTAAKTGS
    ISL2 ENSG00000159556 Homeodomain Known motif – High-throughput in vitro [442] YTAAKTGB
    ISX ENSG00000175329 Homeodomain Known motif – High-throughput in vitro [443] CYAATTAV
    JAZF1 ENSG00000153814 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [444]
    JDP2 ENSG00000140044 bZIP Known motif – High-throughput in vitro [445] RTKACRTMAY
    JRK ENSG00000234616 CENPB Likely sequence specific TF according to literature or domain structure – No motif [446]
    JRKL ENSG00000183340 CENPB Inferred motif from similar protein – High-throughput in vitro [447] RCGGWWR
    JUN ENSG00000177606 bZIP Known motif – High-throughput in vitro [448] DATGACGTMAHNV
    JUNB ENSG00000171223 bZIP Known motif – High-throughput in vitro [449] RTKACGTMAY
    JUND ENSG00000130522 bZIP Known motif – High-throughput in vitro [450] VTGACGTMA
    KAT7 ENSG00000136504 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [451]
    KCMF1 ENSG00000176407 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [452]
    KCNIP3 ENSG00000115041 Unknown Likely sequence specific TF according to literature or domain structure – No motif [453]
    KDM2A ENSG00000173120 CxxC Likely sequence specific TF according to literature or domain structure – No motif [454]
    KDM2B ENSG00000089094 CxxC Known motif – High-throughput in vitro [455] CG
    KDM5B ENSG00000117139 ARID/BRIGHT Likely sequence specific TF according to literature or domain structure – No motif [456]
    KIN ENSG00000151657 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [457]
    KLF1 ENSG00000105610 C2H2 ZF Known motif – High-throughput in vitro [458] CMCGCCCM
    KLF10 ENSG00000155090 C2H2 ZF Known motif – High-throughput in vitro [459] RMCACRCCCMYVHCACRCCCMC
    KLF11 ENSG00000172059 C2H2 ZF Known motif – High-throughput in vitro [460] VMCMCRCCCMYNMCACGCCCMC
    KLF12 ENSG00000118922 C2H2 ZF Known motif – High-throughput in vitro [461] DRCCACGCCCH
    KLF13 ENSG00000169926 C2H2 ZF Known motif – High-throughput in vitro [462] RCCACRCCCMC
    KLF14 ENSG00000266265 C2H2 ZF Known motif – High-throughput in vitro [463] DRHCACGCCCMYYH
    KLF15 ENSG00000163884 C2H2 ZF Known motif – High-throughput in vitro [464] VHCMCVCCCMY
    KLF16 ENSG00000129911 C2H2 ZF Known motif – High-throughput in vitro [465] VMCMCDCCCMC
    KLF17 ENSG00000171872 C2H2 ZF Known motif – High-throughput in vitro [466] MMCCACVCWCCCMTY
    KLF2 ENSG00000127528 C2H2 ZF Known motif – High-throughput in vitro [467] VCCMCRCCCH
    KLF3 ENSG00000109787 C2H2 ZF Known motif – High-throughput in vitro [468] RRCCRCGCCCH
    KLF4 ENSG00000136826 C2H2 ZF Known motif – High-throughput in vitro [469] VCCACRCCCH
    KLF5 ENSG00000102554 C2H2 ZF Known motif – High-throughput in vitro [470] MCACRCCCH
    KLF6 ENSG00000067082 C2H2 ZF Known motif – High-throughput in vitro [471] VMCACRCCCH
    KLF7 ENSG00000118263 C2H2 ZF Known motif – from protein with 100% identical DBD – in vitro [472] HHMCRCCCH
    KLF8 ENSG00000102349 C2H2 ZF Known motif – from protein with 100% identical DBD – in vitro [473] MCRCCY
    KLF9 ENSG00000119138 C2H2 ZF Known motif – from protein with 100% identical DBD – in vitro [474] TAACGG
    KMT2A ENSG00000118058 CxxC; AT hook Known motif – High-throughput in vitro [475] HNCGNB
    KMT2B ENSG00000272333 CxxC; AT hook Likely sequence specific TF according to literature or domain structure – No motif [476]
    L3MBTL1 ENSG00000185513 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [477]
    L3MBTL3 ENSG00000198945 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [478]
    L3MBTL4 ENSG00000154655 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [479]
    LBX1 ENSG00000138136 Homeodomain Known motif – High-throughput in vitro [480] TAAYTRG
    LBX2 ENSG00000179528 Homeodomain Known motif – High-throughput in vitro [481] TAATTRV
    LCOR ENSG00000196233 Pipsqueak Known motif – from protein with 100% identical DBD – in vitro [482] YNAAW
    LCORL ENSG00000178177 Pipsqueak Known motif – High-throughput in vitro [483] HYNAAWH
    LEF1 ENSG00000138795 HMG/Sox Known motif – High-throughput in vitro [484] SATCAAAS
    LEUTX ENSG00000213921 Homeodomain Likely sequence specific TF according to literature or domain structure – No motif [485]
    LHX1 ENSG00000273706 Homeodomain Known motif – High-throughput in vitro [486] TRATBR
    LHX2 ENSG00000106689 Homeodomain Known motif – High-throughput in vitro [487] HHDTTR
    LHX3 ENSG00000107187 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [488] YAATHW
    LHX4 ENSG00000121454 Homeodomain Known motif – High-throughput in vitro [489] BYRATTRV
    LHX5 ENSG00000089116 Homeodomain Known motif – High-throughput in vitro [490] TAATTRS
    LHX6 ENSG00000106852 Homeodomain Known motif – High-throughput in vitro [491] TRATTR
    LHX8 ENSG00000162624 Homeodomain Known motif – High-throughput in vitro [492] STAATTA
    LHX9 ENSG00000143355 Homeodomain Known motif – High-throughput in vitro [493] TAATTRG
    LIN28A ENSG00000131914 CSD Inferred motif from similar protein – High-throughput in vitro [494] CGCHGYYHYWYCGCG
    LIN28B ENSG00000187772 CSD Known motif – High-throughput in vitro [495] CGCHGYYHYWYCGCG
    LIN54 ENSG00000189308 TCR/CxC Inferred motif from similar protein – High-throughput in vitro [496] RTTYAAAH
    LMX1A ENSG00000162761 Homeodomain Known motif – High-throughput in vitro [497] BTAATTA
    LMX1B ENSG00000136944 Homeodomain Known motif – High-throughput in vitro [498] TWATTR
    LTF ENSG00000012223 Unknown Known motif – In vivo/Misc source [499] GKVACTKB
    LYL1 ENSG00000104903 bHLH Inferred motif from similar protein – In vivo/Misc source [500] RNCAGVTGGH
    MAF ENSG00000178573 bZIP Known motif – High-throughput in vitro [501] TGCTGACDHDRCR
    MAFA ENSG00000182759 bZIP Known motif – High-throughput in vitro [502] WWWNTGCTGACD
    MAFB ENSG00000204103 bZIP Known motif – from protein with 100% identical DBD – in vitro [503] TGCTGAC
    MAFF ENSG00000185022 bZIP Known motif – High-throughput in vitro [504] YGCTGASTCAGCR
    MAFG ENSG00000197063 bZIP Known motif – High-throughput in vitro [505] YGCTGABNDNGCR
    MAFK ENSG00000198517 bZIP Known motif – High-throughput in vitro [506] DNNYGCTKAVTCAGCRNNH
    MAX ENSG00000125952 bHLH Known motif – High-throughput in vitro [507] CACGTG
    MAZ ENSG00000103495 C2H2 ZF Known motif – High-throughput in vitro [508] GGGMGGGGS
    MBD1 ENSG00000141644 MBD; CxxC ZF Likely sequence specific TF according to literature or domain structure – No motif [509]
    MBD2 ENSG00000134046 MBD Known motif – In vivo/Misc source [510] VSGKCCGGMKR
    MBD3 ENSG00000071655 MBD Likely sequence specific TF according to literature or domain structure – No motif [511]
    MBD4 ENSG00000129071 MBD Likely sequence specific TF according to literature or domain structure – No motif [512]
    MBD6 ENSG00000166987 MBD Likely sequence specific TF according to literature or domain structure – No motif [513]
    MBNL2 ENSG00000139793 CCCH ZF Likely sequence specific TF according to literature or domain structure – High-throughput in vitro [514] YGCYTYGCYTH
    MECOM ENSG00000085276 C2H2 ZF Known motif – In vivo/Misc source [515] WGAYAAGATAANAND
    MECP2 ENSG00000169057 MBD; AT hook Known motif – from protein with 100% identical DBD – in vitro [516] DTD
    MEF2A ENSG00000068305 MADS box Known motif – High-throughput in vitro [517] KCTAWAAATAGM
    MEF2B ENSG00000213999 MADS box Known motif – High-throughput in vitro [518] TGTTACCATAWHBGG
    MEF2C ENSG00000081189 MADS box Known motif – High-throughput in vitro [519] TWCTAWAAATAG
    MEF2D ENSG00000116604 MADS box Known motif – High-throughput in vitro [520] DCTAWAAATAGM
    MEIS1 ENSG00000143995 Homeodomain Known motif – High-throughput in vitro [521] TGACA
    MEIS2 ENSG00000134138 Homeodomain Known motif – High-throughput in vitro [522] TGACASSTGTC
    MEIS3 ENSG00000105419 Homeodomain Known motif – High-throughput in vitro [523] TGACAGSTGTCA
    MEOX1 ENSG00000005102 Homeodomain Known motif – High-throughput in vitro [524] STAATTA
    MEOX2 ENSG00000106511 Homeodomain Known motif – High-throughput in vitro [525] STMATYA
    MESP1 ENSG00000166823 bHLH Known motif – High-throughput in vitro [526] HVCACCTGB
    MESP2 ENSG00000188095 bHLH Known motif – High-throughput in vitro [527] AMCATATGKYR
    MGA ENSG00000174197 T-box Known motif – High-throughput in vitro [528] AGGTGTKAHDTMACACCT
    MITF ENSG00000187098 bHLH Known motif – from protein with 100% identical DBD – in vitro [529] RTCACGHG
    MIXL1 ENSG00000185155 Homeodomain Known motif – High-throughput in vitro [530] TAATTR
    MKX ENSG00000150051 Homeodomain Likely sequence specific TF according to literature or domain structure – No motif [531]
    MLX ENSG00000108788 bHLH Known motif – High-throughput in vitro [532] VCACGTGVY
    MLXIP ENSG00000175727 bHLH Inferred motif from similar protein – High-throughput in vitro [533] HCACGTGV
    MLXIPL ENSG00000009950 bHLH Known motif – High-throughput in vitro [534] DDCACGTGNH
    MNT ENSG00000070444 bHLH Known motif – High-throughput in vitro [535] DNCACGTGB
    MNX1 ENSG00000130675 Homeodomain Known motif – High-throughput in vitro [536] HTAATTRNH
    MSANTD1 ENSG00000188981 MADF Likely sequence specific TF according to literature or domain structure – No motif [537]
    MSANTD3 ENSG00000066697 MADF Known motif – High-throughput in vitro [538] SBNCACTCAM
    MSANTD4 ENSG00000170903 Myb/SANT Likely sequence specific TF according to literature or domain structure – No motif [539]
    MSC ENSG00000178860 bHLH Known motif – High-throughput in vitro [540] RMCAGCTGBYV
    MSGN1 ENSG00000151379 bHLH Known motif – High-throughput in vitro [541] VMCAWWTGGY
    MSX1 ENSG00000163132 Homeodomain Known motif – High-throughput in vitro [542] TAATTR
    MSX2 ENSG00000120149 Homeodomain Known motif – High-throughput in vitro [543] TAATTGB
    MTERF1 ENSG00000127989 mTERF Known motif – In vivo/Misc source [544] TGGTAVWRKTYGGT
    MTERF2 ENSG00000120832 mTERF Likely sequence specific TF according to literature or domain structure – No motif [545]
    MTERF3 ENSG00000156469 mTERF Likely sequence specific TF according to literature or domain structure – No motif [546]
    MTERF4 ENSG00000122085 mTERF Likely sequence specific TF according to literature or domain structure – No motif [547]
    MTF1 ENSG00000188786 C2H2 ZF Known motif – High-throughput in vitro [548] TTTGCACACGGCAC
    MTF2 ENSG00000143033 Unknown Known motif – High-throughput in vitro [549]
    MXD1 ENSG00000059728 bHLH Inferred motif from similar protein – In vivo/Misc source [550] CACGTGAY
    MXD3 ENSG00000213347 bHLH Inferred motif from similar protein – In vivo/Misc source [551] CACGTGAY
    MXD4 ENSG00000123933 bHLH Inferred motif from similar protein – In vivo/Misc source [552] CACGTGAY
    MXI1 ENSG00000119950 bHLH Known motif – In vivo/Misc source [553] CCACGTGG
    MYB ENSG00000118513 Myb/SANT Known motif – In vivo/Misc source [554] BAACKGNH
    MYBL1 ENSG00000185697 Myb/SANT Known motif – High-throughput in vitro [555] HRACCGTTW
    MYBL2 ENSG00000101057 Myb/SANT Known motif – High-throughput in vitro [556] WAACGGTY
    MYC ENSG00000136997 bHLH Known motif – In vivo/Misc source [557] RCCACGTGSB
    MYCL ENSG00000116990 bHLH Inferred motif from similar protein – In vivo/Misc source [558] RCCACGTG
    MYCN ENSG00000134323 bHLH Known motif – High-throughput in vitro [559] VCACGTG
    MYF5 ENSG00000111049 bHLH Known motif – In vivo/Misc source [560] VCWSCASSTGYCW
    MYF6 ENSG00000111046 bHLH Known motif – High-throughput in vitro [561] RACASSTGWYV
    MYNN ENSG00000085274 C2H2 ZF Known motif – High-throughput in vitro [562] AAAWTAARAGYC
    MYOD1 ENSG00000129152 bHLH Known motif – High-throughput in vitro [563] YGHCAGSTGKYV
    MYOG ENSG00000122180 bHLH Known motif – High-throughput in vitro [564] RACARCTGWCR
    MYPOP ENSG00000176182 Myb/SANT Likely sequence specific TF according to literature or domain structure – No motif [565]
    MYRF ENSG00000124920 Ndt80/PhoG Known motif – High-throughput in vitro [566] TGGTACCA
    MYRFL ENSG00000166268 Ndt80/PhoG Likely sequence specific TF according to literature or domain structure – No motif [567]
    MYSM1 ENSG00000162601 Myb/SANT Likely sequence specific TF according to literature or domain structure – No motif [568]
    MYT1 ENSG00000196132 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [569]
    MYT1L ENSG00000186487 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [570] VAAGTTT
    MZF1 ENSG00000099326 C2H2 ZF Known motif – In vivo/Misc source [571] DRDGGGGAD
    NACC2 ENSG00000148411 Unknown Likely sequence specific TF according to literature or domain structure – No motif [572]
    NAIF1 ENSG00000171169 MADF Inferred motif from similar protein – High-throughput in vitro [573] TACGYH
    NANOG ENSG00000111704 Homeodomain Known motif – High-throughput in vitro [574] YRABBVB
    NANOGNB ENSG00000205857 Homeodomain Likely sequence specific TF according to literature or domain structure – No motif [575]
    NANOGP8 ENSG00000255192 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [576] YRABBVB
    NCOA1 ENSG00000084676 bHLH Likely sequence specific TF according to literature or domain structure – No motif [577]
    NCOA2 ENSG00000140396 bHLH Likely sequence specific TF according to literature or domain structure – No motif [578]
    NCOA3 ENSG00000124151 bHLH Likely sequence specific TF according to literature or domain structure – No motif [579]
    NEUROD1 ENSG00000162992 bHLH Known motif – High-throughput in vitro [580] AAWTANNNBRMCATATGKY
    NEUROD2 ENSG00000171532 bHLH Known motif – High-throughput in vitro [581] RMCATATGBY
    NEUROD4 ENSG00000123307 bHLH Inferred motif from similar protein – High-throughput in vitro [582] AAWTANNNBRMCATATGKY
    NEUROD6 ENSG00000164600 bHLH Inferred motif from similar protein – High-throughput in vitro [583] AAWTANNNBRMCATATGKY
    NEUROG1 ENSG00000181965 bHLH Known motif – High-throughput in vitro [584] RVCATATGBY
    NEUROG2 ENSG00000178403 bHLH Known motif – High-throughput in vitro [585] RVCATATGBY
    NEUROG3 ENSG00000122859 bHLH Inferred motif from similar protein – High-throughput in vitro [586] RVCATATGBY
    NFAT5 ENSG00000102908 Rel Known motif – High-throughput in vitro [587] RTGGAAAWKTACH
    NFATC1 ENSG00000131196 Rel Known motif – High-throughput in vitro [588] RTGGAAAHW
    NFATC2 ENSG00000101096 Rel Known motif – High-throughput in vitro [589] DYGGAAANW
    NFATC3 ENSG00000072736 Rel Known motif – High-throughput in vitro [590] YGGAAANH
    NFATC4 ENSG00000100968 Rel Known motif – High-throughput in vitro [591] YRBWWW
    NFE2 ENSG00000123405 bZIP Known motif – High-throughput in vitro [592] VATGACTCATB
    NFE2L1 ENSG00000082641 bZIP Known motif – In vivo/Misc source [593] ATGAYD
    NFE2L2 ENSG00000116044 bZIP Known motif – In vivo/Misc source [594] VVTGACTMAGCA
    NFE2L3 ENSG00000050344 bZIP Known motif – In vivo/Misc source [595] TATTWSCAAGGA
    NFE4 ENSG00000230257 Unknown Known motif – In vivo/Misc source [596] VHCCCKMKCCWS
    NFIA ENSG00000162599 SMAD Known motif – High-throughput in vitro [597] YTGGCANNNTGCCAA
    NFIB ENSG00000147862 SMAD Known motif – High-throughput in vitro [598] TTGGCANNNTGCCAR
    NFIC ENSG00000141905 SMAD Known motif – High-throughput in vitro [599] YTGGCANNNNGCCAA
    NFIL3 ENSG00000165030 bZIP Known motif – High-throughput in vitro [600] VTTACRTAAY
    NFIX ENSG00000008441 SMAD Known motif – High-throughput in vitro [601] TTGGCANNNTGCCAR
    NFKB1 ENSG00000109320 Rel Known motif – High-throughput in vitro [602] AGGGGAWTCCCCK
    NFKB2 ENSG00000077150 Rel Known motif – High-throughput in vitro [603] VGGGGAWTCCCC
    NFX1 ENSG00000086102 NFX Likely sequence specific TF according to literature or domain structure – No motif [604]
    NFXL1 ENSG00000170448 NFX Likely sequence specific TF according to literature or domain structure – No motif [605]
    NFYA ENSG00000001167 CBF/NF-Y Known motif – In vivo/Misc source [606] HBSYSATTGGYYV
    NFYB ENSG00000120837 Unknown Known motif – In vivo/Misc source [607] CTSATTGGYYVVNNB
    NFYC ENSG00000066136 Unknown Known motif – In vivo/Misc source [608] BSTSATTGGYYR
    NHLH1 ENSG00000171786 bHLH Known motif – High-throughput in vitro [609] DKGRCGCAGCTGMKNCH
    NHLH2 ENSG00000177551 bHLH Known motif – High-throughput in vitro [610] DDGNMGCAGCTGCGYCMH
    NKRF ENSG00000186416 Unknown Likely sequence specific TF according to literature or domain structure – No motif [611]
    NKX1-1 ENSG00000235608 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [612] TAATND
    NKX1-2 ENSG00000229544 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [613] TAAWND
    NKX2-1 ENSG00000136352 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [614] RAGDR
    NKX2-2 ENSG00000125820 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [615] RAGDR
    NKX2-3 ENSG00000119919 Homeodomain Known motif – High-throughput in vitro [616] VCACTTV
    NKX2-4 ENSG00000125816 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [617] RAGDR
    NKX2-5 ENSG00000183072 Homeodomain Known motif – High-throughput in vitro [618] VCACTTRDV
    NKX2-6 ENSG00000180053 Homeodomain Inferred motif from similar protein – High-throughput in vitro [619] HYAAGTRB
    NKX2-8 ENSG00000136327 Homeodomain Known motif – High-throughput in vitro [620] BTSRAGTGB
    NKX3-1 ENSG00000167034 Homeodomain Known motif – High-throughput in vitro [621] TAAGTGS
    NKX3-2 ENSG00000109705 Homeodomain Known motif – High-throughput in vitro [622] TAAGTGS
    NKX6-1 ENSG00000163623 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [623] DTDATNR
    NKX6-2 ENSG00000148826 Homeodomain Known motif – High-throughput in vitro [624] DTAATTR
    NKX6-3 ENSG00000165066 Homeodomain Known motif – High-throughput in vitro [625] WTAATGRB
    NME2 ENSG00000243678 Unknown Likely sequence specific TF according to literature or domain structure – No motif [626]
    NOBOX ENSG00000106410 Homeodomain Known motif – High-throughput in vitro [627] HDATDR
    NOTO ENSG00000214513 Homeodomain Known motif – High-throughput in vitro [628] YWMATTA
    NPAS1 ENSG00000130751 bHLH Inferred motif from similar protein – In vivo/Misc source [629] VVNGCACGTMBNS
    NPAS2 ENSG00000170485 bHLH Known motif – High-throughput in vitro [630] DMCACGTGY
    NPAS3 ENSG00000151322 bHLH Inferred motif from similar protein – In vivo/Misc source [631] VVNGCACGTMBNS
    NPAS4 ENSG00000174576 bHLH Inferred motif from similar protein – High-throughput in vitro [632]
    NR0B1 ENSG00000169297 Unknown Known motif – In vivo/Misc source [633] YBTYCCMCKS
    NR1D1 ENSG00000126368 Nuclear receptor Known motif – High-throughput in vitro [634] TGACCYASTRACCYANWW
    NR1D2 ENSG00000174738 Nuclear receptor Known motif – High-throughput in vitro [635] YRACMYANTRACMYMNWWH
    NR1H2 ENSG00000131408 Nuclear receptor Known motif – In vivo/Misc source [636] TAAAGGTCAAAGGTCAASK
    NR1H3 ENSG00000025434 Nuclear receptor Inferred motif from similar protein – In vivo/Misc source [637] TAAAGGTCAAAGGTCAASK
    NR1H4 ENSG00000012504 Nuclear receptor Known motif – High-throughput in vitro [638] RGKTCRTTGACCYBNNRGGTBADRGKKBNDRGKTCAHHKD
    NR1I2 ENSG00000144852 Nuclear receptor Known motif – High-throughput in vitro [639] YGMMCYBNNYGMMCY
    NR1I3 ENSG00000143257 Nuclear receptor Known motif – High-throughput in vitro [640] RGKDYRNNNNRGKKYR
    NR2C1 ENSG00000120798 Nuclear receptor Known motif – High-throughput in vitro [641] RGKKCRYGAMMY
    NR2C2 ENSG00000177463 Nuclear receptor Known motif – High-throughput in vitro [642] VRGGTCAAAGGTCA
    NR2E1 ENSG00000112333 Nuclear receptor Known motif – High-throughput in vitro [643] AAGTCA
    NR2E3 ENSG00000278570 Nuclear receptor Known motif – High-throughput in vitro [644] RAGATCAM
    NR2F1 ENSG00000175745 Nuclear receptor Known motif – High-throughput in vitro [645] RRGGTCAAAGGTCA
    NR2F2 ENSG00000185551 Nuclear receptor Known motif – from protein with 100% identical DBD – in vitro [646] RRGGTCA
    NR2F6 ENSG00000160113 Nuclear receptor Known motif – High-throughput in vitro [647] RGGTCAAAGGTCA
    NR3C1 ENSG00000113580 Nuclear receptor Known motif – High-throughput in vitro [648] RGWACAYNRTGTWCYH
    NR3C2 ENSG00000151623 Nuclear receptor Known motif – High-throughput in vitro [649] RGDACAHDRTGTHCY
    NR4A1 ENSG00000123358 Nuclear receptor Known motif – High-throughput in vitro [650] AAAGGTCA
    NR4A2 ENSG00000153234 Nuclear receptor Known motif – High-throughput in vitro [651] BTAAAGGTCA
    NR4A3 ENSG00000119508 Nuclear receptor Known motif – In vivo/Misc source [652] CAAAGGTCAS
    NR5A1 ENSG00000136931 Nuclear receptor Known motif – High-throughput in vitro [653] CAAGGYCR
    NR5A2 ENSG00000116833 Nuclear receptor Known motif – High-throughput in vitro [654] YCAAGGTCAH
    NR6A1 ENSG00000148200 Nuclear receptor Known motif – High-throughput in vitro [655] SAAGKTCAAGKKYR
    NRF1 ENSG00000106459 Unknown Known motif – High-throughput in vitro [656] YRCGCATGCGC
    NRL ENSG00000129535 bZIP Known motif – High-throughput in vitro [657] DWHNYGCTGAC
    OLIG1 ENSG00000184221 bHLH Known motif – High-throughput in vitro [658] AVCATATGKT
    OLIG2 ENSG00000205927 bHLH Known motif – High-throughput in vitro [659] AMCATATGKY
    OLIG3 ENSG00000177468 bHLH Known motif – High-throughput in vitro [660] RSCATATGKY
    ONECUT1 ENSG00000169856 CUT; Homeodomain Known motif – High-throughput in vitro [661] DDTATCGATYD
    ONECUT2 ENSG00000119547 CUT; Homeodomain Known motif – High-throughput in vitro [662] DTATCGATCS
    ONECUT3 ENSG00000205922 CUT; Homeodomain Known motif – High-throughput in vitro [663] DWTATYGATTTTY
    OSR1 ENSG00000143867 C2H2 ZF Known motif – High-throughput in vitro [664] HACRGTAGC
    OSR2 ENSG00000164920 C2H2 ZF Known motif – High-throughput in vitro [665] HVCRGTAGC
    OTP ENSG00000171540 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [666] HAATND
    OTX1 ENSG00000115507 Homeodomain Known motif – High-throughput in vitro [667] TAATCSB
    OTX2 ENSG00000165588 Homeodomain Known motif – High-throughput in vitro [668] HTAATCCB
    OVOL1 ENSG00000172818 C2H2 ZF Known motif – High-throughput in vitro [669] RNRTAACGGTHH
    OVOL2 ENSG00000125850 C2H2 ZF Known motif – High-throughput in vitro [670] DNNTARCGGD
    OVOL3 ENSG00000105261 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [671]
    PA2G4 ENSG00000170515 Unknown Likely sequence specific TF according to literature or domain structure – No motif [672]
    PATZ1 ENSG00000100105 C2H2 ZF; AT hook Known motif – In vivo/Misc source [673] GGGHGGGG
    PAX1 ENSG00000125813 Paired box Known motif – High-throughput in vitro [674] SGTCACGCWTSANTGVH
    PAX2 ENSG00000075891 Homeodomain; Paired box Known motif – High-throughput in vitro [675] SGTCACGCWTSRNTGVNY
    PAX3 ENSG00000135903 Homeodomain; Paired box Known motif – High-throughput in vitro [676] TAATCRATTA
    PAX4 ENSG00000106331 Homeodomain; Paired box Known motif – High-throughput in vitro [677] HKAATTAR
    PAX5 ENSG00000196092 Paired box Known motif – High-throughput in vitro [678] GTYACGSWTSRNTRVNY
    PAX6 ENSG00000007372 Homeodomain; Paired box Known motif – High-throughput in vitro [679] YACGCHYSRNYRMNY
    PAX7 ENSG00000009709 Homeodomain; Paired box Known motif – High-throughput in vitro [680] TAATYRATTW
    PAX8 ENSG00000125618 Paired box Known motif – High-throughput in vitro [681] RNBYRNYSRWGCGTGACS
    PAX9 ENSG00000198807 Paired box Known motif – High-throughput in vitro [682] SGTCACGCWTSANTGM
    PBX1 ENSG00000185630 Homeodomain Known motif – High-throughput in vitro [683] TGATKGAYR
    PBX2 ENSG00000204304 Homeodomain Known motif – In vivo/Misc source [684] KRVHKTGATTGAWK
    PBX3 ENSG00000167081 Homeodomain Known motif – In vivo/Misc source [685] BBBTGATTGRYND
    PBX4 ENSG00000105717 Homeodomain Known motif – High-throughput in vitro [686] HDWHH
    PCGF2 ENSG00000277258 Unknown Likely sequence specific TF according to literature or domain structure – No motif [687]
    PCGF6 ENSG00000156374 Unknown Likely sequence specific TF according to literature or domain structure – No motif [688]
    PDX1 ENSG00000139515 Homeodomain Known motif – High-throughput in vitro [689] BTAATKR
    PEG3 ENSG00000198300 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [690]
    PGR ENSG00000082175 Nuclear receptor Known motif – High-throughput in vitro [691] RGNACRNNNTGTNCH
    PHF1 ENSG00000112511 Unknown Known motif – High-throughput in vitro [692]
    PHF19 ENSG00000119403 Unknown Likely sequence specific TF according to literature or domain structure – No motif [693]
    PHF20 ENSG00000025293 AT hook Likely sequence specific TF according to literature or domain structure – No motif [694]
    PHF21A ENSG00000135365 AT hook Likely sequence specific TF according to literature or domain structure – No motif [695]
    PHOX2A ENSG00000165462 Homeodomain Known motif – High-throughput in vitro [696] TAATTRVRTTA
    PHOX2B ENSG00000109132 Homeodomain Known motif – High-throughput in vitro [697] TAATTRVRTTA
    PIN1 ENSG00000127445 MBD Likely sequence specific TF according to literature or domain structure – No motif [698]
    PITX1 ENSG00000069011 Homeodomain Known motif – High-throughput in vitro [699] HTAATCC
    PITX2 ENSG00000164093 Homeodomain Known motif – High-throughput in vitro [700] TAAKCC
    PITX3 ENSG00000107859 Homeodomain Known motif – High-throughput in vitro [701] HTAATCC
    PKNOX1 ENSG00000160199 Homeodomain Known motif – High-throughput in vitro [702] TGACAGCTGTCA
    PKNOX2 ENSG00000165495 Homeodomain Known motif – High-throughput in vitro [703] TGACAGSTGTCA
    PLAG1 ENSG00000181690 C2H2 ZF Known motif – High-throughput in vitro [704] GGGGCCHWMGGGGG
    PLAGL1 ENSG00000118495 C2H2 ZF Known motif – In vivo/Misc source [705] RGGCCCCCYB
    PLAGL2 ENSG00000126003 C2H2 ZF Known motif – High-throughput in vitro [706] RGGGGCCC
    PLSCR1 ENSG00000188313 Unknown Likely sequence specific TF according to literature or domain structure – No motif [707]
    POGK ENSG00000143157 Brinker Likely sequence specific TF according to literature or domain structure – No motif [708]
    POU1F1 ENSG00000064835 Homeodomain; POU Known motif – High-throughput in vitro [709] DWTATGCWAATKAD
    POU2AF1 ENSG00000110777 Unknown Known motif – In vivo/Misc source [710] GATKTGCAKAT
    POU2F1 ENSG00000143190 Homeodomain; POU Known motif – High-throughput in vitro [711] WTGMATATKYADD
    POU2F2 ENSG00000028277 Homeodomain; POU Known motif – High-throughput in vitro [712] DTGMATATKYADD
    POU2F3 ENSG00000137709 Homeodomain; POU Known motif – High-throughput in vitro [713] TATGYWAAT
    POU3F1 ENSG00000185668 Homeodomain; POU Known motif – High-throughput in vitro [714] WTATGYWAATD
    POU3F2 ENSG00000184486 Homeodomain; POU Known motif – High-throughput in vitro [715] WTATGYWAATKW
    POU3F3 ENSG00000198914 Homeodomain; POU Known motif – High-throughput in vitro [716] WWDMWTAWKHAW
    POU3F4 ENSG00000196767 Homeodomain; POU Known motif – High-throughput in vitro [717] WDAWTTATKCA
    POU4F1 ENSG00000152192 Homeodomain; POU Known motif – High-throughput in vitro [718] TDMATWATKYA
    POU4F2 ENSG00000151615 Homeodomain; POU Known motif – High-throughput in vitro [719] BTMATTAAWTATKCA
    POU4F3 ENSG00000091010 Homeodomain; POU Known motif – High-throughput in vitro [720] RTNMATWATKYAT
    POU5F1 ENSG00000204531 Homeodomain; POU Known motif – High-throughput in vitro [721] WTATGYWAATKWVB
    POU5F1B ENSG00000212993 Homeodomain; POU Known motif – High-throughput in vitro [722] TATGYWAAT
    POU5F2 ENSG00000248483 Homeodomain; POU Likely sequence specific TF according to literature or domain structure – No motif [723]
    POU6F1 ENSG00000184271 Homeodomain; POU Known motif – High-throughput in vitro [724] MTCATTAH
    POU6F2 ENSG00000106536 Homeodomain; POU Known motif – High-throughput in vitro [725] DTAATKAGBH
    PPARA ENSG00000186951 Nuclear receptor Known motif – In vivo/Misc source [726] DAGGTCA
    PPARD ENSG00000112033 Nuclear receptor Known motif – High-throughput in vitro [727] RRGGTCAAAGGTCA
    PPARG ENSG00000132170 Nuclear receptor Known motif – from protein with 100% identical DBD – in vitro [728] VNTRMCCYANWDNRACCTWTNVCCYVNW
    PRDM1 ENSG00000057657 C2H2 ZF Known motif – High-throughput in vitro [729] RAAAGTGAAAGTD
    PRDM10 ENSG00000170325 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [730]
    PRDM12 ENSG00000130711 C2H2 ZF Known motif – In vivo/Misc source [731] GACAGNTKACC
    PRDM13 ENSG00000112238 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [732]
    PRDM14 ENSG00000147596 C2H2 ZF Known motif – In vivo/Misc source [733] RSTTAGRGACCY
    PRDM15 ENSG00000141956 C2H2 ZF Known motif – In vivo/Misc source [734] DTGGAAHTCCMA
    PRDM16 ENSG00000142611 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [735] DAGAYAAGATAANM
    PRDM2 ENSG00000116731 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [736]
    PRDM4 ENSG00000110851 C2H2 ZF Known motif – High-throughput in vitro [737] TTTCAAGGCCCCC
    PRDM5 ENSG00000138738 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [738]
    PRDM6 ENSG00000061455 C2H2 ZF Known motif – In vivo/Misc source [739] RVARDRRAAADDVWRRAAAA
    PRDM8 ENSG00000152784 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [740]
    PRDM9 ENSG00000164256 C2H2 ZF Known motif – High-throughput in vitro [741] VGNGGBNRSGGDGGNNNNARVRRV
    PREB ENSG00000138073 Unknown Likely sequence specific TF according to literature or domain structure – No motif [742]
    PRMT3 ENSG00000185238 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [743]
    PROP1 ENSG00000175325 Homeodomain Known motif – High-throughput in vitro [744] TAAYYNMATTA
    PROX1 ENSG00000117707 Prospero Known motif – High-throughput in vitro [745] BAAGACGYCTTV
    PROX2 ENSG00000119608 Prospero Inferred motif from similar protein – High-throughput in vitro [746] BAMGRCGTCDTV
    PRR12 ENSG00000126464 AT hook Likely sequence specific TF according to literature or domain structure – No motif [747]
    PRRX1 ENSG00000116132 Homeodomain Known motif – High-throughput in vitro [748] TAATTR
    PRRX2 ENSG00000167157 Homeodomain Known motif – High-throughput in vitro [749] TAATTRV
    PTF1A ENSG00000168267 bHLH Known motif – High-throughput in vitro [750] VYGTCAGCTGTT
    PURA ENSG00000185129 Unknown Known motif – In vivo/Misc source [751] CYMBGSCHNCMMMBWCC
    PURB ENSG00000146676 Unknown Likely sequence specific TF according to literature or domain structure – No motif [752]
    PURG ENSG00000172733 Unknown Likely sequence specific TF according to literature or domain structure – No motif [753]
    RAG1 ENSG00000166349 Unknown Likely sequence specific TF according to literature or domain structure – No motif [754]
    RARA ENSG00000131759 Nuclear receptor Known motif – High-throughput in vitro [755] RRGGTCANV
    RARB ENSG00000077092 Nuclear receptor Known motif – High-throughput in vitro [756] TGACCYYTTGACCYY
    RARG ENSG00000172819 Nuclear receptor Known motif – High-throughput in vitro [757] VGGTCA
    RAX ENSG00000134438 Homeodomain Known motif – High-throughput in vitro [758] HTAATTR
    RAX2 ENSG00000173976 Homeodomain Known motif – High-throughput in vitro [759] TAATTR
    RBAK ENSG00000146587 C2H2 ZF Known motif – High-throughput in vitro [760] VGDRASRARVRRSV
    RBCK1 ENSG00000125826 Unknown Likely sequence specific TF according to literature or domain structure – No motif [761]
    RBPJ ENSG00000168214 CSL Known motif – High-throughput in vitro [762] BTCHCA
    RBPJL ENSG00000124232 CSL Inferred motif from similar protein – In vivo/Misc source [763] DTTCCCABR
    RBSN ENSG00000131381 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [764]
    REL ENSG00000162924 Rel Known motif – In vivo/Misc source [765] GGAAWNYCCV
    RELA ENSG00000173039 Rel Known motif – In vivo/Misc source [766] BKGGAAAKYCCCH
    RELB ENSG00000104856 Rel Known motif – In vivo/Misc source [767] DKSAAAKYCCCB
    REPIN1 ENSG00000214022 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [768]
    REST ENSG00000084093 C2H2 ZF Known motif – In vivo/Misc source [769] DTCAGSACCWYGGACAGCDSC
    REXO4 ENSG00000148300 Unknown Likely sequence specific TF according to literature or domain structure – No motif [770]
    RFX1 ENSG00000132005 RFX Known motif – High-throughput in vitro [771] BGTTRYCATGRYAACV
    RFX2 ENSG00000087903 RFX Known motif – High-throughput in vitro [772] BGTTRCCATGGYAACV
    RFX3 ENSG00000080298 RFX Known motif – High-throughput in vitro [773] BGTTDCCATGGYAAC
    RFX4 ENSG00000111783 RFX Known motif – High-throughput in vitro [774] GTWRYCATRGHWAC
    RFX5 ENSG00000143390 RFX Known motif – High-throughput in vitro [775] BGTTGCYATGGYAACV
    RFX6 ENSG00000185002 RFX Inferred motif from similar protein – High-throughput in vitro [776] GTHDYYNNS
    RFX7 ENSG00000181827 RFX Known motif – High-throughput in vitro [777] BGTTRCYRY
    RFX8 ENSG00000196460 RFX Likely sequence specific TF according to literature or domain structure – No motif [778]
    RHOXF1 ENSG00000101883 Homeodomain Known motif – High-throughput in vitro [779] TRAKCCH
    RHOXF2 ENSG00000131721 Homeodomain Known motif – High-throughput in vitro [780] TAATCC
    RHOXF2B ENSG00000203989 Homeodomain Inferred motif from similar protein – High-throughput in vitro [781] TAATCC
    RLF ENSG00000117000 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [782]
    RORA ENSG00000069667 Nuclear receptor Known motif – High-throughput in vitro [783] MRAGGTCAAVYYVAGGTCA
    RORB ENSG00000198963 Nuclear receptor Known motif – High-throughput in vitro [784] AWNBRGGTCA
    RORC ENSG00000143365 Nuclear receptor Known motif – High-throughput in vitro [785] TGMCCYANWTH
    RREB1 ENSG00000124782 C2H2 ZF Known motif – In vivo/Misc source [786] MCMCMAMMCAMCMMCHMMSV
    RUNX1 ENSG00000159216 Runt Known motif – In vivo/Misc source [787] VACCACAV
    RUNX2 ENSG00000124813 Runt Known motif – High-throughput in vitro [788] HRACCRCADWAACCRCAV
    RUNX3 ENSG00000020633 Runt Known motif – High-throughput in vitro [789] WAACCRCAR
    RXRA ENSG00000186350 Nuclear receptor Known motif – High-throughput in vitro [790] RRGGTCAAAGGTCA
    RXRB ENSG00000204231 Nuclear receptor Known motif – High-throughput in vitro [791] RRGGTCAAAGGTCA
    RXRG ENSG00000143171 Nuclear receptor Known motif – High-throughput in vitro [792] RRGGTCAAAGGTCA
    SAFB ENSG00000160633 Unknown Likely sequence specific TF according to literature or domain structure – No motif [793]
    SAFB2 ENSG00000130254 Unknown Likely sequence specific TF according to literature or domain structure – No motif [794]
    SALL1 ENSG00000103449 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [795] RYYCAAAAB
    SALL2 ENSG00000165821 C2H2 ZF Known motif – In vivo/Misc source [796] CCCACCC
    SALL3 ENSG00000256463 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [797]
    SALL4 ENSG00000101115 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [798] GCTGATAACAGV
    SATB1 ENSG00000182568 CUT; Homeodomain Known motif – In vivo/Misc source [799] WKWWWTAAHGRYMNWW
    SATB2 ENSG00000119042 CUT; Homeodomain Inferred motif from similar protein – In vivo/Misc source [800] WKWWWTAAHGRYMNWW
    SCMH1 ENSG00000010803 Unknown Likely sequence specific TF according to literature or domain structure – No motif [801]
    SCML4 ENSG00000146285 AT hook Likely sequence specific TF according to literature or domain structure – No motif [802]
    SCRT1 ENSG00000261678 C2H2 ZF Known motif – High-throughput in vitro [803] KCAACAGGTD
    SCRT2 ENSG00000215397 C2H2 ZF Known motif – High-throughput in vitro [804] RHGCAACAGGTGB
    SCX ENSG00000260428 bHLH Inferred motif from similar protein – High-throughput in vitro [805] VCRKMYGB
    SEBOX ENSG00000274529 Homeodomain Inferred motif from similar protein – High-throughput in vitro [806] HTTAATTA
    SETBP1 ENSG00000152217 AT hook Likely sequence specific TF according to literature or domain structure – No motif [807]
    SETDB1 ENSG00000143379 MBD Known motif – In vivo/Misc source [808] RACTHCMDYTCCCRKVRDGCHNYG
    SETDB2 ENSG00000136169 MBD Likely sequence specific TF according to literature or domain structure – No motif [809]
    SGSM2 ENSG00000141258 BED ZF Likely sequence specific TF according to literature or domain structure – No motif [810]
    SHOX ENSG00000185960 Homeodomain Known motif – High-throughput in vitro [811] TAATTR
    SHOX2 ENSG00000168779 Homeodomain Known motif – High-throughput in vitro [812] BTAATTR
    SIM1 ENSG00000112246 bHLH Inferred motif from similar protein – In vivo/Misc source [813] VVNGCACGTMBNS
    SIM2 ENSG00000159263 bHLH Inferred motif from similar protein – In vivo/Misc source [814] VVNGCACGTMBNS
    SIX1 ENSG00000126778 Homeodomain Known motif – High-throughput in vitro [815] VBGTATCR
    SIX2 ENSG00000170577 Homeodomain Known motif – High-throughput in vitro [816] VSGTATCR
    SIX3 ENSG00000138083 Homeodomain Known motif – High-throughput in vitro [817] VVTATCR
    SIX4 ENSG00000100625 Homeodomain Known motif – High-throughput in vitro [818] VBGTATCRB
    SIX5 ENSG00000177045 Homeodomain Known motif – In vivo/Misc source [819] GGAGTTGT
    SIX6 ENSG00000184302 Homeodomain Known motif – High-throughput in vitro [820] VBSTATCR
    SKI ENSG00000157933 Unknown Likely sequence specific TF according to literature or domain structure – No motif [821]
    SKIL ENSG00000136603 Unknown Likely sequence specific TF according to literature or domain structure – No motif [822]
    SKOR1 ENSG00000188779 Unknown Known motif – High-throughput in vitro [823] WNVKGTAATTAMB
    SKOR2 ENSG00000215474 SAND Known motif – High-throughput in vitro [824] WNVKGTAATTAA
    SLC2A4RG ENSG00000125520 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [825]
    SMAD1 ENSG00000170365 SMAD Known motif – In vivo/Misc source [826] DRCAGASAGGSH
    SMAD3 ENSG00000166949 SMAD Known motif – High-throughput in vitro [827] YGTCTAGACA
    SMAD4 ENSG00000141646 SMAD Known motif – from protein with 100% identical DBD – in vitro [828] KCYAGACR
    SMAD5 ENSG00000113658 SMAD Known motif – High-throughput in vitro [829] YGTCTAGACW
    SMAD9 ENSG00000120693 SMAD Known motif – In vivo/Misc source [830] WGGTCTAGMCMT
    SMYD3 ENSG00000185420 Unknown Likely sequence specific TF according to literature or domain structure – No motif [831]
    SNAI1 ENSG00000124216 C2H2 ZF Known motif – High-throughput in vitro [832] VCACCTGY
    SNAI2 ENSG00000019549 C2H2 ZF Known motif – High-throughput in vitro [833] RRCAGGTGYR
    SNAI3 ENSG00000185669 C2H2 ZF Known motif – High-throughput in vitro [834] DRCAGGTGYR
    SNAPC2 ENSG00000104976 Unknown Likely sequence specific TF according to literature or domain structure – No motif [835]
    SNAPC4 ENSG00000165684 Myb/SANT Likely sequence specific TF according to literature or domain structure – No motif [836]
    SNAPC5 ENSG00000174446 Unknown Likely sequence specific TF according to literature or domain structure – No motif [837]
    SOHLH1 ENSG00000165643 bHLH Likely sequence specific TF according to literature or domain structure – No motif [838]
    SOHLH2 ENSG00000120669 bHLH Known motif – High-throughput in vitro [839] BCACGTGC
    SON ENSG00000159140 Unknown Likely sequence specific TF according to literature or domain structure – No motif [840]
    SOX1 ENSG00000182968 HMG/Sox Known motif – from protein with 100% identical DBD – in vitro [841] WBAAW
    SOX10 ENSG00000100146 HMG/Sox Known motif – High-throughput in vitro [842] DAACAWWGVV
    SOX11 ENSG00000176887 HMG/Sox Known motif – from protein with 100% identical DBD – in vitro [843] VACAAW
    SOX12 ENSG00000177732 HMG/Sox Known motif – High-throughput in vitro [844] MCCGAACAAT
    SOX13 ENSG00000143842 HMG/Sox Known motif – from protein with 100% identical DBD – in vitro [845] RAACAATW
    SOX14 ENSG00000168875 HMG/Sox Known motif – High-throughput in vitro [846] WCAATR
    SOX15 ENSG00000129194 HMG/Sox Known motif – High-throughput in vitro [847] ATCAATAMCATTGAT
    SOX17 ENSG00000164736 HMG/Sox Known motif – High-throughput in vitro [848] DRACAATRV
    SOX18 ENSG00000203883 HMG/Sox Known motif – High-throughput in vitro [849] ATCAATGHWATTGAT
    SOX2 ENSG00000181449 HMG/Sox Known motif – High-throughput in vitro [850] HATCAATANCATTGATH
    SOX21 ENSG00000125285 HMG/Sox Known motif – High-throughput in vitro [851] TCAMTRHCATTGA
    SOX3 ENSG00000134595 HMG/Sox Known motif – High-throughput in vitro [852] SBNAMAATRB
    SOX30 ENSG00000039600 HMG/Sox Known motif – High-throughput in vitro [853] RACAAT
    SOX4 ENSG00000124766 HMG/Sox Known motif – High-throughput in vitro [854] AACAAWGR
    SOX5 ENSG00000134532 HMG/Sox Known motif – High-throughput in vitro [855] DVACAATRV
    SOX6 ENSG00000110693 HMG/Sox Known motif – High-throughput in vitro [856] DRACAATRV
    SOX7 ENSG00000171056 HMG/Sox Known motif – High-throughput in vitro [857] DAACAATKDYAKTGTT
    SOX8 ENSG00000005513 HMG/Sox Known motif – High-throughput in vitro [858] HATCAATTKCAGTGAT
    SOX9 ENSG00000125398 HMG/Sox Known motif – High-throughput in vitro [859] DDACAATRV
    SP1 ENSG00000185591 C2H2 ZF Known motif – High-throughput in vitro [860] RCCMCDCCCMH
    SP100 ENSG00000067066 SAND Likely sequence specific TF according to literature or domain structure – No motif [861]
    SP110 ENSG00000135899 SAND Likely sequence specific TF according to literature or domain structure – No motif [862]
    SP140 ENSG00000079263 SAND Likely sequence specific TF according to literature or domain structure – No motif [863]
    SP140L ENSG00000185404 SAND Likely sequence specific TF according to literature or domain structure – No motif [864]
    SP2 ENSG00000167182 C2H2 ZF Known motif – High-throughput in vitro [865] YWAGYCCCGCCCMCYH
    SP3 ENSG00000172845 C2H2 ZF Known motif – High-throughput in vitro [866] VCCMCRCCCMY
    SP4 ENSG00000105866 C2H2 ZF Known motif – High-throughput in vitro [867] WRGCCACGCCCMCHY
    SP5 ENSG00000204335 C2H2 ZF Known motif – In vivo/Misc source [868] ACCVCGCCKCCSS
    SP6 ENSG00000189120 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [869] HNGCCACGCCCARK
    SP7 ENSG00000170374 C2H2 ZF Known motif – In vivo/Misc source [870] VBNSGGGGNGG
    SP8 ENSG00000164651 C2H2 ZF Known motif – High-throughput in vitro [871] VMCACBCCCMCH
    SP9 ENSG00000217236 C2H2 ZF Known motif – High-throughput in vitro [872] VMCMCGCCCMYH
    SPDEF ENSG00000124664 Ets Known motif – High-throughput in vitro [873] AMCCGGATRTD
    SPEN ENSG00000065526 Unknown Likely sequence specific TF according to literature or domain structure – No motif [874]
    SPI1 ENSG00000066336 Ets Known motif – High-throughput in vitro [875] RAAAAGMGGAAGTW
    SPIB ENSG00000269404 Ets Known motif – High-throughput in vitro [876] WWWRVGGAAST
    SPIC ENSG00000166211 Ets Known motif – High-throughput in vitro [877] RAAWSVGGAAGTM
    SPZ1 ENSG00000164299 Unknown Known motif – In vivo/Misc source [878] GGSDGWWMCVBHBG
    SRCAP ENSG00000080603 AT hook Likely sequence specific TF according to literature or domain structure – No motif [879]
    SREBF1 ENSG00000072310 bHLH Known motif – High-throughput in vitro [880] VHCACVCSAY
    SREBF2 ENSG00000198911 bHLH Known motif – High-throughput in vitro [881] RTCACGTGAY
    SRF ENSG00000112658 MADS box Known motif – High-throughput in vitro [882] DCCWTATATGGT
    SRY ENSG00000184895 HMG/Sox Known motif – High-throughput in vitro [883] AACAATGNTATTGTT
    ST18 ENSG00000147488 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [884] VAAGTTT
    STAT1 ENSG00000115415 STAT Known motif – In vivo/Misc source [885] HTTCCYRGAAR
    STAT2 ENSG00000170581 STAT Known motif – In vivo/Misc source [886] TNRGTTTCDNTTYC
    STAT3 ENSG00000168610 STAT Known motif – In vivo/Misc source [887] HTTCCYRKMA
    STAT4 ENSG00000138378 STAT Known motif – In vivo/Misc source [888] BDHTTCTBGKAAD
    STAT5A ENSG00000126561 STAT Known motif – In vivo/Misc source [889] YTTCYNRGAAHY
    STAT5B ENSG00000173757 STAT Known motif – In vivo/Misc source [890] ADTTCYHRGAAA
    STAT6 ENSG00000166888 STAT Known motif – In vivo/Misc source [891] DWTTYCNDDGAA
    T ENSG00000164458 T-box Known motif – High-throughput in vitro [892] ANGTGYGAHWWNTVRCACCT
    TAL1 ENSG00000162367 bHLH Known motif – In vivo/Misc source [893] RNCAGVTGGH
    TAL2 ENSG00000186051 bHLH Inferred motif from similar protein – In vivo/Misc source [894] RNCAGVTGGH
    TBP ENSG00000112592 TBP Known motif – from protein with 100% identical DBD – in vitro [895] WWWWAW
    TBPL1 ENSG00000028839 TBP Likely sequence specific TF according to literature or domain structure – No motif [896]
    TBPL2 ENSG00000182521 TBP Inferred motif from similar protein – High-throughput in vitro [897] WWWWAW
    TBR1 ENSG00000136535 T-box Known motif – High-throughput in vitro [898] TTCACACCT
    TBX1 ENSG00000184058 T-box Known motif – High-throughput in vitro [899] TCACACCT
    TBX10 ENSG00000167800 T-box Inferred motif from similar protein – High-throughput in vitro [900] BYTCACACCYHV
    TBX15 ENSG00000092607 T-box Known motif – High-throughput in vitro [901] TCACACCT
    TBX18 ENSG00000112837 T-box Known motif – High-throughput in vitro [902] BYTCACACCTHH
    TBX19 ENSG00000143178 T-box Known motif – High-throughput in vitro [903] TMRCACNTABGTGYBAH
    TBX2 ENSG00000121068 T-box Known motif – High-throughput in vitro [904] VRCRC
    TBX20 ENSG00000164532 T-box Known motif – High-throughput in vitro [905] TCACRCBYTMACACCT
    TBX21 ENSG00000073861 T-box Known motif – High-throughput in vitro [906] WTCACACCTH
    TBX22 ENSG00000122145 T-box Known motif – In vivo/Misc source [907] AGGTGWSAAWTTCACACCT
    TBX3 ENSG00000135111 T-box Known motif – High-throughput in vitro [908] YVACACSH
    TBX4 ENSG00000121075 T-box Known motif – High-throughput in vitro [909] TVACACCT
    TBX5 ENSG00000089225 T-box Known motif – High-throughput in vitro [910] TVACACCT
    TBX6 ENSG00000149922 T-box Known motif – High-throughput in vitro [911] TVACACSY
    TCF12 ENSG00000140262 bHLH Known motif – High-throughput in vitro [912] VCACSTGB
    TCF15 ENSG00000125878 bHLH Inferred motif from similar protein – High-throughput in vitro [913] VCRKMYGB
    TCF20 ENSG00000100207 Unknown Likely sequence specific TF according to literature or domain structure – No motif [914]
    TCF21 ENSG00000118526 bHLH Known motif – High-throughput in vitro [915] RVCAGCTGTTV
    TCF23 ENSG00000163792 bHLH Inferred motif from similar protein – High-throughput in vitro [916] VCRKMYGB
    TCF24 ENSG00000261787 bHLH Inferred motif from similar protein – High-throughput in vitro [917] RMCAKMTGK
    TCF3 ENSG00000071564 bHLH Known motif – High-throughput in vitro [918] VCAGGTGB
    TCF4 ENSG00000196628 bHLH Known motif – High-throughput in vitro [919] HRCACCTGB
    TCF7 ENSG00000081059 HMG/Sox Known motif – High-throughput in vitro [920] DSATCAAWS
    TCF7L1 ENSG00000152284 HMG/Sox Known motif – High-throughput in vitro [921] AAAGATCAAAGG
    TCF7L2 ENSG00000148737 HMG/Sox Known motif – from protein with 100% identical DBD – in vitro [922] SWTCAAAV
    TCFL5 ENSG00000101190 bHLH Known motif – High-throughput in vitro [923] KCRCGCGCHC
    TEAD1 ENSG00000187079 TEA Known motif – High-throughput in vitro [924] RCATTCCDH
    TEAD2 ENSG00000074219 TEA Known motif – High-throughput in vitro [925] YRCATTCCW
    TEAD3 ENSG00000007866 TEA Known motif – High-throughput in vitro [926] RCATTCYDNDCATWCCD
    TEAD4 ENSG00000197905 TEA Known motif – High-throughput in vitro [927] RMATTCYD
    TEF ENSG00000167074 bZIP Known motif – High-throughput in vitro [928] VTTACRTAAB
    TERB1 ENSG00000249961 Myb/SANT Likely sequence specific TF according to literature or domain structure – No motif [929]
    TERF1 ENSG00000147601 Myb/SANT Likely sequence specific TF according to literature or domain structure – No motif [930]
    TERF2 ENSG00000132604 Myb/SANT Inferred motif from similar protein – High-throughput in vitro [931] AACCCTAV
    TET1 ENSG00000138336 CxxC Known motif – High-throughput in vitro [932] HVCGH
    TET2 ENSG00000168769 Unknown Likely sequence specific TF according to literature or domain structure – No motif [933]
    TET3 ENSG00000187605 CxxC Likely sequence specific TF according to literature or domain structure – No motif [934]
    TFAP2A ENSG00000137203 AP-2 Known motif – High-throughput in vitro [935] HSCCYBVRGGCD
    TFAP2B ENSG00000008196 AP-2 Known motif – High-throughput in vitro [936] SCCBNVGGS
    TFAP2C ENSG00000087510 AP-2 Known motif – High-throughput in vitro [937] HGCCYBVRGGSD
    TFAP2D ENSG00000008197 AP-2 Known motif – In vivo/Misc source [938] RCGNGCCBCRGVCB
    TFAP2E ENSG00000116819 AP-2 Known motif – High-throughput in vitro [939] HSCCYSRGGSD
    TFAP4 ENSG00000090447 bHLH Known motif – High-throughput in vitro [940] VWCAGCTGWB
    TFCP2 ENSG00000135457 Grainyhead Known motif – High-throughput in vitro [941] WCCGGWWHDAWCYGGW
    TFCP2L1 ENSG00000115112 Grainyhead Known motif – High-throughput in vitro [942] DCYRGHNNNDDCYRGH
    TFDP1 ENSG00000198176 E2F Known motif – In vivo/Misc source [943] DYYTCSCGCYMWWY
    TFDP2 ENSG00000114126 E2F Inferred motif from similar protein – In vivo/Misc source [944] DYYTCSCGCYMWWY
    TFDP3 ENSG00000183434 E2F Inferred motif from similar protein – In vivo/Misc source [945] DYYTCSCGCYMWWY
    TFE3 ENSG00000068323 bHLH Known motif – High-throughput in vitro [946] RKCACGTGNB
    TFEB ENSG00000112561 bHLH Known motif – High-throughput in vitro [947] RNCACGTGAY
    TFEC ENSG00000105967 bHLH Known motif – High-throughput in vitro [948] RNCACRTGAB
    TGIF1 ENSG00000177426 Homeodomain Known motif – High-throughput in vitro [949] TGACAGCTGTCA
    TGIF2 ENSG00000118707 Homeodomain Known motif – High-throughput in vitro [950] TGACABVTGTCA
    TGIF2LX ENSG00000153779 Homeodomain Known motif – High-throughput in vitro [951] TGACASSTGTCA
    TGIF2LY ENSG00000176679 Homeodomain Known motif – High-throughput in vitro [952] TGACABVTGTCA
    THAP1 ENSG00000131931 THAP finger Known motif – In vivo/Misc source [953] BYYGCCMKNANYMAAVATGGCSV
    THAP10 ENSG00000129028 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [954]
    THAP11 ENSG00000168286 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [955]
    THAP12 ENSG00000137492 THAP finger Known motif – High-throughput in vitro [956] YMBNNBGR
    THAP2 ENSG00000173451 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [957]
    THAP3 ENSG00000041988 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [958]
    THAP4 ENSG00000176946 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [959]
    THAP5 ENSG00000177683 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [960]
    THAP6 ENSG00000174796 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [961]
    THAP7 ENSG00000184436 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [962]
    THAP8 ENSG00000161277 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [963]
    THAP9 ENSG00000168152 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [964]
    THRA ENSG00000126351 Nuclear receptor Known motif – High-throughput in vitro [965] DTGACCTBATRAGGTCAH
    THRB ENSG00000151090 Nuclear receptor Known motif – High-throughput in vitro [966] TGWCCTBRNYVAGGWCA
    THYN1 ENSG00000151500 Unknown Likely sequence specific TF according to literature or domain structure – No motif [967]
    TIGD1 ENSG00000221944 CENPB Known motif – High-throughput in vitro [968] SCGCAATA
    TIGD2 ENSG00000180346 CENPB Inferred motif from similar protein – High-throughput in vitro [969] RCGGWWR
    TIGD3 ENSG00000173825 CENPB Likely sequence specific TF according to literature or domain structure – No motif [970]
    TIGD4 ENSG00000169989 CENPB Likely sequence specific TF according to literature or domain structure – No motif [971]
    TIGD5 ENSG00000179886 CENPB Likely sequence specific TF according to literature or domain structure – No motif [972]
    TIGD6 ENSG00000164296 CENPB Inferred motif from similar protein – High-throughput in vitro [973] WVCRWA
    TIGD7 ENSG00000140993 CENPB Likely sequence specific TF according to literature or domain structure – No motif [974]
    TLX1 ENSG00000107807 Homeodomain Known motif – In vivo/Misc source [975] VCHHVTTRVCV
    TLX2 ENSG00000115297 Homeodomain Known motif – High-throughput in vitro [976] BTAATTR
    TLX3 ENSG00000164438 Homeodomain Known motif – High-throughput in vitro [977] AATKGNNNNNNNNNNNNNCAATT
    TMF1 ENSG00000144747 Unknown Likely sequence specific TF according to literature or domain structure – No motif [978]
    TOPORS ENSG00000197579 Unknown Known motif – In vivo/Misc source [979] TCCCAGCTACTTTGGGA
    TP53 ENSG00000141510 p53 Known motif – In vivo/Misc source [980] DRCATGYYBRGRCATGYCY
    TP63 ENSG00000073282 p53 Known motif – High-throughput in vitro [981] DACATGTYVYRACATGTY
    TP73 ENSG00000078900 p53 Known motif – In vivo/Misc source [982] DRRCAWGYHCWGRCWTGYH
    TPRX1 ENSG00000178928 Homeodomain Likely sequence specific TF according to literature or domain structure – No motif [983]
    TRAFD1 ENSG00000135148 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [984]
    TRERF1 ENSG00000124496 C2H2 ZF; Myb/SANT Inferred motif from similar protein – In vivo/Misc source [985] AGACKTTAGTCA
    TRPS1 ENSG00000104447 GATA Known motif – In vivo/Misc source [986] HWSRARATAGWDDMH
    TSC22D1 ENSG00000102804 Unknown Likely sequence specific TF according to literature or domain structure – No motif [987]
    TSHZ1 ENSG00000179981 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [988]
    TSHZ2 ENSG00000182463 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [989]
    TSHZ3 ENSG00000121297 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [990]
    TTF1 ENSG00000125482 Myb/SANT Likely sequence specific TF according to literature or domain structure – No motif [991]
    TWIST1 ENSG00000122691 bHLH Known motif – In vivo/Misc source [992] MHVCACHTGSD
    TWIST2 ENSG00000233608 bHLH Known motif – from protein with 100% identical DBD – in vitro [993] MCATATGT
    UBP1 ENSG00000153560 Grainyhead Known motif – High-throughput in vitro [994] DCYRGHNNNNDCYRGH
    UNCX ENSG00000164853 Homeodomain Known motif – High-throughput in vitro [995] TAATTR
    USF1 ENSG00000158773 bHLH Known motif – High-throughput in vitro [996] RNCACGTGRY
    USF2 ENSG00000105698 bHLH Known motif – High-throughput in vitro [997] VCACGTGVC
    USF3 ENSG00000176542 bHLH Likely sequence specific TF according to literature or domain structure – No motif [998]
    VAX1 ENSG00000148704 Homeodomain Known motif – High-throughput in vitro [999] YTAATKA
    VAX2 ENSG00000116035 Homeodomain Known motif – High-throughput in vitro [1,000] YTAATKA
    VDR ENSG00000111424 Nuclear receptor Known motif – High-throughput in vitro [1,001] TGAACYCDRTGAACYC
    VENTX ENSG00000151650 Homeodomain Known motif – High-throughput in vitro [1,002] VNTAATBR
    VEZF1 ENSG00000136451 C2H2 ZF Known motif – High-throughput in vitro [1,003] RKGGGGGG
    VSX1 ENSG00000100987 Homeodomain Known motif – High-throughput in vitro [1,004] TAATTRS
    VSX2 ENSG00000119614 Homeodomain Known motif – High-throughput in vitro [1,005] YTAATTA
    WIZ ENSG00000011451 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,006]
    WT1 ENSG00000184937 C2H2 ZF Known motif – High-throughput in vitro [1,007] BGGGGGRG
    XBP1 ENSG00000100219 bZIP Known motif – High-throughput in vitro [1,008] GVTGACGTGKCVHW
    XPA ENSG00000136936 Unknown Known motif – High-throughput in vitro [1,009] VCACCTCACMY
    YBX1 ENSG00000065978 CSD Known motif – High-throughput in vitro [1,010] YGTWCCAYC
    YBX2 ENSG00000006047 CSD Inferred motif from similar protein – High-throughput in vitro [1,011] YGTWCCAYC
    YBX3 ENSG00000060138 CSD Known motif – from protein with 100% identical DBD – in vitro [1,012] YGTWCCAYC
    YY1 ENSG00000100811 C2H2 ZF Known motif – High-throughput in vitro [1,013] HRWNATGGCB
    YY2 ENSG00000230797 C2H2 ZF Known motif – High-throughput in vitro [1,014] DDNATGGCGG
    ZBED1 ENSG00000214717 BED ZF Known motif – High-throughput in vitro [1,015] YATGTCGCGAYAD
    ZBED2 ENSG00000177494 BED ZF Likely sequence specific TF according to literature or domain structure – No motif [1,016]
    ZBED3 ENSG00000132846 BED ZF Likely sequence specific TF according to literature or domain structure – No motif [1,017]
    ZBED4 ENSG00000100426 BED ZF Likely sequence specific TF according to literature or domain structure – No motif [1,018]
    ZBED5 ENSG00000236287 BED ZF Likely sequence specific TF according to literature or domain structure – No motif [1,019]
    ZBED6 ENSG00000257315 BED ZF Inferred motif from similar protein – In vivo/Misc source [1,020] VVRGCGAGCYYV
    ZBED9 ENSG00000232040 BED ZF Likely sequence specific TF according to literature or domain structure – No motif [1,021]
    ZBTB1 ENSG00000126804 C2H2 ZF Known motif – from protein with 100% identical DBD – in vitro [1,022] HMMCGCRH
    ZBTB10 ENSG00000205189 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,023]
    ZBTB11 ENSG00000066422 C2H2 ZF Known motif – In vivo/Misc source [1,024] GGGGKGCRCMCA
    ZBTB12 ENSG00000204366 C2H2 ZF Known motif – High-throughput in vitro [1,025] CTAGAACMB
    ZBTB14 ENSG00000198081 C2H2 ZF Known motif – High-throughput in vitro [1,026] VDCGTGCACGCGCRH
    ZBTB16 ENSG00000109906 C2H2 ZF Known motif – In vivo/Misc source [1,027] BTVNWYBKVHKBTAAADYWKKRHYWRDKY
    ZBTB17 ENSG00000116809 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,028]
    ZBTB18 ENSG00000179456 C2H2 ZF Known motif – High-throughput in vitro [1,029] DKCCAGATGTK
    ZBTB2 ENSG00000181472 C2H2 ZF Known motif – High-throughput in vitro [1,030] DKWACCGGRA
    ZBTB20 ENSG00000181722 C2H2 ZF Known motif – High-throughput in vitro [1,031] VYATACRTYV
    ZBTB21 ENSG00000173276 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,032]
    ZBTB22 ENSG00000236104 C2H2 ZF Known motif – High-throughput in vitro [1,033] HKCACWAYNRTWGTGMD
    ZBTB24 ENSG00000112365 C2H2 ZF; AT hook Likely sequence specific TF according to literature or domain structure – No motif [1,034]
    ZBTB25 ENSG00000089775 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,035]
    ZBTB26 ENSG00000171448 C2H2 ZF Known motif – High-throughput in vitro [1,036] DHTCYAGAAHR
    ZBTB3 ENSG00000185670 C2H2 ZF Known motif – from protein with 100% identical DBD – in vitro [1,037] DSCAGYK
    ZBTB32 ENSG00000011590 C2H2 ZF Known motif – High-throughput in vitro [1,038] HGTACAGTRWYACTGTACD
    ZBTB33 ENSG00000177485 C2H2 ZF Known motif – In vivo/Misc source [1,039] SVNTCTCGCGAGANB
    ZBTB34 ENSG00000177125 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [1,040] DTCGGCYAABDCGGCA
    ZBTB37 ENSG00000185278 C2H2 ZF Known motif – High-throughput in vitro [1,041] DTCGGCYAABDCGGCA
    ZBTB38 ENSG00000177311 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,042]
    ZBTB39 ENSG00000166860 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,043]
    ZBTB4 ENSG00000174282 C2H2 ZF Known motif – In vivo/Misc source [1,044] CVCHAHCRCYMTBG
    ZBTB40 ENSG00000184677 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,045]
    ZBTB41 ENSG00000177888 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,046]
    ZBTB42 ENSG00000179627 C2H2 ZF Known motif – High-throughput in vitro [1,047] MRCAKCTGS
    ZBTB43 ENSG00000169155 C2H2 ZF Known motif – High-throughput in vitro [1,048] GTGCTRNNNNNDDGGCAC
    ZBTB44 ENSG00000196323 C2H2 ZF Known motif – High-throughput in vitro [1,049] RMTGCAKB
    ZBTB45 ENSG00000119574 C2H2 ZF Known motif – High-throughput in vitro [1,050] BMTATAGGBR
    ZBTB46 ENSG00000130584 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,051]
    ZBTB47 ENSG00000114853 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,052]
    ZBTB48 ENSG00000204859 C2H2 ZF Known motif – In vivo/Misc source [1,053] YHAGGGANHDD
    ZBTB49 ENSG00000168826 C2H2 ZF Known motif – High-throughput in vitro [1,054] TGACVBGYCARGCRRAA
    ZBTB5 ENSG00000168795 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,055]
    ZBTB6 ENSG00000186130 C2H2 ZF Known motif – In vivo/Misc source [1,056] VGRTGMTRGAGCC
    ZBTB7A ENSG00000178951 C2H2 ZF Known motif – High-throughput in vitro [1,057] RCGACCACCNV
    ZBTB7B ENSG00000160685 C2H2 ZF Known motif – High-throughput in vitro [1,058] DCGACCMCCVA
    ZBTB7C ENSG00000184828 C2H2 ZF Known motif – High-throughput in vitro [1,059] DCRACCACCVH
    ZBTB8A ENSG00000160062 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,060]
    ZBTB8B ENSG00000273274 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,061]
    ZBTB9 ENSG00000213588 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,062]
    ZC3H8 ENSG00000144161 CCCH ZF Likely sequence specific TF according to literature or domain structure – No motif [1,063]
    ZEB1 ENSG00000148516 C2H2 ZF; Homeodomain Known motif – In vivo/Misc source [1,064] CAGGTGNR
    ZEB2 ENSG00000169554 C2H2 ZF; Homeodomain Inferred motif from similar protein – In vivo/Misc source [1,065] CAGGTGNR
    ZFAT ENSG00000066827 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,066]
    ZFHX2 ENSG00000136367 Homeodomain Known motif – High-throughput in vitro [1,067] TRATYA
    ZFHX3 ENSG00000140836 C2H2 ZF; Homeodomain Known motif – High-throughput in vitro [1,068] RMTND
    ZFHX4 ENSG00000091656 C2H2 ZF; Homeodomain Inferred motif from similar protein – In vivo/Misc source [1,069] WAATWAWTAAY
    ZFP1 ENSG00000184517 C2H2 ZF Known motif – High-throughput in vitro [1,070] TDYBATACCCANHH
    ZFP14 ENSG00000142065 C2H2 ZF Known motif – High-throughput in vitro [1,071] GGAGSHHHHDGARHK
    ZFP2 ENSG00000198939 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,072] RGRAAVYGAAACT
    ZFP28 ENSG00000196867 C2H2 ZF Known motif – High-throughput in vitro [1,073] AYMNHWRARGAAAHDGARMKVHHDNDNNDNNH
    ZFP3 ENSG00000180787 C2H2 ZF Known motif – High-throughput in vitro [1,074] GGNTGNRTAGGAGYTYDB
    ZFP30 ENSG00000120784 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [1,075] RAHRNRGYTRNRDRNRG
    ZFP37 ENSG00000136866 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,076]
    ZFP41 ENSG00000181638 C2H2 ZF Known motif – High-throughput in vitro [1,077] RYGGAGAGTTAGC
    ZFP42 ENSG00000179059 C2H2 ZF Known motif – High-throughput in vitro [1,078] CAAKATGGCBGHC
    ZFP57 ENSG00000204644 C2H2 ZF Known motif – In vivo/Misc source [1,079] SNNVNNVBTGCCGCV
    ZFP62 ENSG00000196670 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,080]
    ZFP64 ENSG00000020256 C2H2 ZF Known motif – In vivo/Misc source [1,081] VGGRSCCCGGGVVNS
    ZFP69 ENSG00000187815 C2H2 ZF Known motif – High-throughput in vitro [1,082] GWGRCTRGAWAC
    ZFP69B ENSG00000187801 C2H2 ZF Known motif – High-throughput in vitro [1,083] GTGGCTGGARVV
    ZFP82 ENSG00000181007 C2H2 ZF Known motif – High-throughput in vitro [1,084] AGAATTAGTRAAYTGGAARAY
    ZFP90 ENSG00000184939 C2H2 ZF Known motif – High-throughput in vitro [1,085] RYACTGCTTTWG
    ZFP91 ENSG00000186660 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,086]
    ZFP92 ENSG00000189420 C2H2 ZF Known motif – In vivo/Misc source [1,087] MGATAAAAKGM
    ZFPM1 ENSG00000179588 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,088]
    ZFPM2 ENSG00000169946 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,089]
    ZFX ENSG00000005889 C2H2 ZF Known motif – In vivo/Misc source [1,090] VVSVSBNBBAGGCCBVGSH
    ZFY ENSG00000067646 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,091] BAGGCCBVGSYBVV
    ZGLP1 ENSG00000220201 GATA Likely sequence specific TF according to literature or domain structure – No motif [1,092]
    ZGPAT ENSG00000197114 CCCH ZF Likely sequence specific TF according to literature or domain structure – No motif [1,093]
    ZHX1 ENSG00000165156 Homeodomain Known motif – High-throughput in vitro [1,094] DYB
    ZHX2 ENSG00000178764 Homeodomain Likely sequence specific TF according to literature or domain structure – No motif [1,095]
    ZHX3 ENSG00000174306 Homeodomain Likely sequence specific TF according to literature or domain structure – No motif [1,096]
    ZIC1 ENSG00000152977 C2H2 ZF Known motif – High-throughput in vitro [1,097] DCRCAGCRGGGGGBV
    ZIC2 ENSG00000043355 C2H2 ZF Known motif – from protein with 100% identical DBD – in vitro [1,098] YNRBRKG
    ZIC3 ENSG00000156925 C2H2 ZF Known motif – High-throughput in vitro [1,099] KCACAGCRGGGGGTCB
    ZIC4 ENSG00000174963 C2H2 ZF Known motif – High-throughput in vitro [1,100] DCNCHRCRGGGGGYM
    ZIC5 ENSG00000139800 C2H2 ZF Known motif – High-throughput in vitro [1,101] DCDCAGCGGGGGGTM
    ZIK1 ENSG00000171649 C2H2 ZF Known motif – High-throughput in vitro [1,102] RDRRCAAWRGCAMNRVRWNNB
    ZIM2 ENSG00000269699 C2H2 ZF Known motif – In vivo/Misc source [1,103] YCNBSYBSCYTYYYCHBCCVGCCYGKGGYY
    ZIM3 ENSG00000141946 C2H2 ZF Known motif – High-throughput in vitro [1,104] RNHAACAGAAANCYM
    ZKSCAN1 ENSG00000106261 C2H2 ZF Known motif – High-throughput in vitro [1,105] CCTACTAHGH
    ZKSCAN2 ENSG00000155592 C2H2 ZF Known motif – High-throughput in vitro [1,106] RRRRRMMAC
    ZKSCAN3 ENSG00000189298 C2H2 ZF Known motif – High-throughput in vitro [1,107] TCGAGGYTAGMCCA
    ZKSCAN4 ENSG00000187626 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,108]
    ZKSCAN5 ENSG00000196652 C2H2 ZF Known motif – High-throughput in vitro [1,109] DGGAGGTGA
    ZKSCAN7 ENSG00000196345 C2H2 ZF Known motif – High-throughput in vitro [1,110] VYAHACTKTNRAGYGV
    ZKSCAN8 ENSG00000198315 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,111]
    ZMAT1 ENSG00000166432 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,112]
    ZMAT4 ENSG00000165061 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,113]
    ZNF10 ENSG00000256223 C2H2 ZF Known motif – High-throughput in vitro [1,114] TGAGGT
    ZNF100 ENSG00000197020 C2H2 ZF Known motif – High-throughput in vitro [1,115] VBRNGGCGGCGGCNB
    ZNF101 ENSG00000181896 C2H2 ZF Known motif – High-throughput in vitro [1,116] VDGYKGCCCCHGTRTCH
    ZNF107 ENSG00000196247 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,117]
    ZNF112 ENSG00000062370 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,118]
    ZNF114 ENSG00000178150 C2H2 ZF Known motif – In vivo/Misc source [1,119] VSSSBSBVVSSBSSSSYHTWTATABVSB
    ZNF117 ENSG00000152926 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,120] GKGCWGCAGM
    ZNF12 ENSG00000164631 C2H2 ZF Known motif – High-throughput in vitro [1,121] VYGCKRTAACAARYAKSMCC
    ZNF121 ENSG00000197961 C2H2 ZF Known motif – High-throughput in vitro [1,122] VCDGGVCMRVDBWGYVNGRYCCH
    ZNF124 ENSG00000196418 C2H2 ZF Known motif – High-throughput in vitro [1,123] AAGAAGGCTTTAATYRGG
    ZNF131 ENSG00000172262 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,124]
    ZNF132 ENSG00000131849 C2H2 ZF Known motif – High-throughput in vitro [1,125] VRGGARRGNRGGARG
    ZNF133 ENSG00000125846 C2H2 ZF Known motif – High-throughput in vitro [1,126] DGRNMCAAMWNANGTAHAAKTGGHDNH
    ZNF134 ENSG00000213762 C2H2 ZF Known motif – High-throughput in vitro [1,127] VYTMAKCAGKKGMNG
    ZNF135 ENSG00000176293 C2H2 ZF Known motif – High-throughput in vitro [1,128] HHYTGAGGTYGAGCY
    ZNF136 ENSG00000196646 C2H2 ZF Known motif – High-throughput in vitro [1,129] TTCTTGGTTGRCAGKTTT
    ZNF138 ENSG00000197008 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,130]
    ZNF14 ENSG00000105708 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,131]
    ZNF140 ENSG00000196387 C2H2 ZF Known motif – High-throughput in vitro [1,132] GAGCGGAATTGYH
    ZNF141 ENSG00000131127 C2H2 ZF Known motif – High-throughput in vitro [1,133] RVKGRGRGYGKCCCCC
    ZNF142 ENSG00000115568 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,134]
    ZNF143 ENSG00000166478 C2H2 ZF Known motif – High-throughput in vitro [1,135] YWCCCAYAATGCAYYG
    ZNF146 ENSG00000167635 C2H2 ZF Known motif – High-throughput in vitro [1,136] GGARTAYTABDCAGC
    ZNF148 ENSG00000163848 C2H2 ZF Known motif – In vivo/Misc source [1,137] DGKGGGRGGD
    ZNF154 ENSG00000179909 C2H2 ZF Known motif – High-throughput in vitro [1,138] TGTCTAGTARRTCYD
    ZNF155 ENSG00000204920 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,139]
    ZNF157 ENSG00000147117 C2H2 ZF Known motif – High-throughput in vitro [1,140] KNNDNGYRYAYTGHWDNCCYYVCCADGHCH
    ZNF16 ENSG00000170631 C2H2 ZF Known motif – High-throughput in vitro [1,141] GAGCCAYDGMRGGYKBTD
    ZNF160 ENSG00000170949 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,142]
    ZNF165 ENSG00000197279 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,143]
    ZNF169 ENSG00000175787 C2H2 ZF Known motif – High-throughput in vitro [1,144] CTCCCT
    ZNF17 ENSG00000186272 C2H2 ZF Known motif – High-throughput in vitro [1,145] VNBNNNNNSTKYMTGYTCHKGNNNV
    ZNF174 ENSG00000103343 C2H2 ZF Known motif – High-throughput in vitro [1,146] GSCRAGTGAYYGNC
    ZNF175 ENSG00000105497 C2H2 ZF Known motif – In vivo/Misc source [1,147] CYAYACAHRAYAADGAATACA
    ZNF177 ENSG00000188629 C2H2 ZF Known motif – High-throughput in vitro [1,148] BTYGRTCKMRNKKNNVAGTCATD
    ZNF18 ENSG00000154957 C2H2 ZF Known motif – High-throughput in vitro [1,149] SNRTTCACACY
    ZNF180 ENSG00000167384 C2H2 ZF Known motif – High-throughput in vitro [1,150] VGGGVSNGGNGGSGRSBGSGGCVV
    ZNF181 ENSG00000197841 C2H2 ZF Known motif – High-throughput in vitro [1,151] VYYYSWGSTWSTNGGRMKGMKGHB
    ZNF182 ENSG00000147118 C2H2 ZF Known motif – High-throughput in vitro [1,152] AAAAMMAAAARMAAA
    ZNF184 ENSG00000096654 C2H2 ZF Known motif – High-throughput in vitro [1,153] TGGWGARGA
    ZNF189 ENSG00000136870 C2H2 ZF Known motif – High-throughput in vitro [1,154] VDGGAASRGMVDNDS
    ZNF19 ENSG00000157429 C2H2 ZF Known motif – High-throughput in vitro [1,155] DRGGVBHHDGACRNNDV
    ZNF195 ENSG00000005801 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,156]
    ZNF197 ENSG00000186448 C2H2 ZF Known motif – High-throughput in vitro [1,157] RRRGWCARRRRVVVR
    ZNF2 ENSG00000275111 C2H2 ZF Known motif – High-throughput in vitro [1,158] SCVCVGVGCYGCGC
    ZNF20 ENSG00000132010 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,159]
    ZNF200 ENSG00000010539 C2H2 ZF Known motif – High-throughput in vitro [1,160] BVNVSCGGAAGY
    ZNF202 ENSG00000166261 C2H2 ZF Known motif – In vivo/Misc source [1,161] CSCNBCYYCCDCYBCYBSBBCSBSBSCYB
    ZNF205 ENSG00000122386 C2H2 ZF Known motif – In vivo/Misc source [1,162] TGGAAT
    ZNF207 ENSG00000010244 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,163]
    ZNF208 ENSG00000160321 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,164]
    ZNF211 ENSG00000121417 C2H2 ZF Known motif – High-throughput in vitro [1,165] HNYATATACCAB
    ZNF212 ENSG00000170260 C2H2 ZF Known motif – In vivo/Misc source [1,166] CACACAHVHMCACRC
    ZNF213 ENSG00000085644 C2H2 ZF Known motif – High-throughput in vitro [1,167] MGAMMBCRGGCGGMG
    ZNF214 ENSG00000149050 C2H2 ZF Known motif – High-throughput in vitro [1,168] VWTMATYAANRTCCTCAAVAABD
    ZNF215 ENSG00000149054 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,169]
    ZNF217 ENSG00000171940 C2H2 ZF Known motif – In vivo/Misc source [1,170] GKNRGAAT
    ZNF219 ENSG00000165804 C2H2 ZF Known motif – In vivo/Misc source [1,171] DGGGGGGYGGW
    ZNF22 ENSG00000165512 C2H2 ZF Known motif – High-throughput in vitro [1,172] AAAAAAAAA
    ZNF221 ENSG00000159905 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,173]
    ZNF222 ENSG00000159885 C2H2 ZF Known motif – High-throughput in vitro [1,174] GCTGMSAYB
    ZNF223 ENSG00000178386 C2H2 ZF Known motif – In vivo/Misc source [1,175] MCACACASASM
    ZNF224 ENSG00000267680 C2H2 ZF Known motif – High-throughput in vitro [1,176] WMCYYNKGDGYHMHRKGRMTY
    ZNF225 ENSG00000256294 C2H2 ZF Known motif – In vivo/Misc source [1,177] TTAYCWKYDKNRYTTYTTTYTTTTTYYH
    ZNF226 ENSG00000167380 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,178]
    ZNF227 ENSG00000131115 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,179]
    ZNF229 ENSG00000278318 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,180]
    ZNF23 ENSG00000167377 C2H2 ZF Known motif – High-throughput in vitro [1,181] DCRMCCATGGCCGCGHCM
    ZNF230 ENSG00000159882 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,182]
    ZNF232 ENSG00000167840 C2H2 ZF Known motif – High-throughput in vitro [1,183] RTGTTAAAYGTRGATTAAS
    ZNF233 ENSG00000159915 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,184]
    ZNF234 ENSG00000263002 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,185]
    ZNF235 ENSG00000159917 C2H2 ZF Known motif – High-throughput in vitro [1,186] AARARADRAARRAAAWNRDDWDVDNNAWDR
    ZNF236 ENSG00000130856 C2H2 ZF Known motif – In vivo/Misc source [1,187] MGTAATATTVM
    ZNF239 ENSG00000196793 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,188]
    ZNF24 ENSG00000172466 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,189]
    ZNF248 ENSG00000198105 C2H2 ZF Known motif – High-throughput in vitro [1,190] RHDDACHATRTYCAKBRA
    ZNF25 ENSG00000175395 C2H2 ZF Known motif – In vivo/Misc source [1,191] WGAADWANAVARGTYGCWGCATTTAGAAA
    ZNF250 ENSG00000196150 C2H2 ZF Known motif – High-throughput in vitro [1,192] YASGCCYAY
    ZNF251 ENSG00000198169 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,193]
    ZNF253 ENSG00000256771 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,194]
    ZNF254 ENSG00000213096 C2H2 ZF Known motif – High-throughput in vitro [1,195] ACTGGCYTAGCCTCCCAGCCTACATCTTTCTCC
    ZNF256 ENSG00000152454 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,196]
    ZNF257 ENSG00000197134 C2H2 ZF Known motif – High-throughput in vitro [1,197] GAGGMRA
    ZNF26 ENSG00000198393 C2H2 ZF Known motif – In vivo/Misc source [1,198] ATTTTT
    ZNF260 ENSG00000254004 C2H2 ZF Known motif – High-throughput in vitro [1,199] GGARDRVDANRVDRV
    ZNF263 ENSG00000006194 C2H2 ZF Known motif – High-throughput in vitro [1,200] GGGAGSACB
    ZNF264 ENSG00000083844 C2H2 ZF Known motif – High-throughput in vitro [1,201] KKGRGSCCYYHNBRATGGGATTAGTGCCCT
    ZNF266 ENSG00000174652 C2H2 ZF Known motif – High-throughput in vitro [1,202] VNHRCTCACAGSYCC
    ZNF267 ENSG00000185947 C2H2 ZF Known motif – High-throughput in vitro [1,203] VSYNVVGGCNKGBGVRGVDG
    ZNF268 ENSG00000090612 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,204]
    ZNF273 ENSG00000198039 C2H2 ZF Known motif – High-throughput in vitro [1,205] GARAGGAGCTAC
    ZNF274 ENSG00000171606 C2H2 ZF Known motif – High-throughput in vitro [1,206] VYGAGRACTCAYRY
    ZNF275 ENSG00000063587 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,207]
    ZNF276 ENSG00000158805 C2H2 ZF Known motif – High-throughput in vitro [1,208] WAAGGWSGWVDMKACNHCCTTWA
    ZNF277 ENSG00000198839 C2H2 ZF; BED ZF Likely sequence specific TF according to literature or domain structure – No motif [1,209]
    ZNF28 ENSG00000198538 C2H2 ZF Known motif – High-throughput in vitro [1,210] GBNKSHGGGGTGCCM
    ZNF280A ENSG00000169548 C2H2 ZF Known motif – In vivo/Misc source [1,211] TCTCWCCWGTRTGRRTTCTYTSAT
    ZNF280B ENSG00000275004 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,212]
    ZNF280C ENSG00000056277 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,213]
    ZNF280D ENSG00000137871 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,214]
    ZNF281 ENSG00000162702 C2H2 ZF Known motif – High-throughput in vitro [1,215] KGGGGGAGGGGS
    ZNF282 ENSG00000170265 C2H2 ZF Known motif – High-throughput in vitro [1,216] HTCCCMYNACMCK
    ZNF283 ENSG00000167637 C2H2 ZF Known motif – High-throughput in vitro [1,217] BNGGCTGRTSBKGSYBGGSYB
    ZNF284 ENSG00000186026 C2H2 ZF Known motif – High-throughput in vitro [1,218] GCTGGAGTGCAG
    ZNF285 ENSG00000267508 C2H2 ZF Known motif – In vivo/Misc source [1,219] TNTTYTYBYTYDYTYTNHTTT
    ZNF286A ENSG00000187607 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,220]
    ZNF286B ENSG00000249459 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,221]
    ZNF287 ENSG00000141040 C2H2 ZF Known motif – High-throughput in vitro [1,222] AAAARAAAARRWARMARAVMWRRARRAVADR
    ZNF292 ENSG00000188994 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,223]
    ZNF296 ENSG00000170684 C2H2 ZF Known motif – High-throughput in vitro [1,224] VVTGWCCASYV
    ZNF3 ENSG00000166526 C2H2 ZF Known motif – High-throughput in vitro [1,225] TGAHTGAMTRANWGA
    ZNF30 ENSG00000168661 C2H2 ZF Known motif – High-throughput in vitro [1,226] CGGACGGGGCGGCTG
    ZNF300 ENSG00000145908 C2H2 ZF Known motif – In vivo/Misc source [1,227] KKDGWRDDDGNRKBNDDGDDKKNRNBKRKR
    ZNF302 ENSG00000089335 C2H2 ZF Known motif – High-throughput in vitro [1,228] AGTTGAGTGACTGYDSTT
    ZNF304 ENSG00000131845 C2H2 ZF Known motif – High-throughput in vitro [1,229] VVGRSYVGRBYGGGGMVGGNV
    ZNF311 ENSG00000197935 C2H2 ZF Known motif – In vivo/Misc source [1,230] YYSCDGCBSBNBCYS
    ZNF316 ENSG00000205903 C2H2 ZF Known motif – In vivo/Misc source [1,231] KCCSCCGGACCH
    ZNF317 ENSG00000130803 C2H2 ZF Known motif – High-throughput in vitro [1,232] RACAGMWGACWD
    ZNF318 ENSG00000171467 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,233]
    ZNF319 ENSG00000166188 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,234]
    ZNF32 ENSG00000169740 C2H2 ZF Known motif – High-throughput in vitro [1,235] BGTAAYNYGAYACB
    ZNF320 ENSG00000182986 C2H2 ZF Known motif – High-throughput in vitro [1,236] CMYHKKCCCCYKGVHCCCMC
    ZNF322 ENSG00000181315 C2H2 ZF Known motif – High-throughput in vitro [1,237] VVGGCHSHGKASCAGDCHS
    ZNF324 ENSG00000083812 C2H2 ZF Known motif – High-throughput in vitro [1,238] GRTYRAACCATCCY
    ZNF324B ENSG00000249471 C2H2 ZF Known motif – In vivo/Misc source [1,239] HHHDGSMRGSHRAGG
    ZNF326 ENSG00000162664 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,240]
    ZNF329 ENSG00000181894 C2H2 ZF Known motif – High-throughput in vitro [1,241] CYKGAKCMVVCYNNDCCTGMA
    ZNF331 ENSG00000130844 C2H2 ZF Known motif – High-throughput in vitro [1,242] VVAVSSNNMYWGCWGAGCMCWKYCH
    ZNF333 ENSG00000160961 C2H2 ZF Known motif – High-throughput in vitro [1,243] STGGAKSM
    ZNF334 ENSG00000198185 C2H2 ZF Known motif – In vivo/Misc source [1,244] YCCGKSMGGGAGGTGRGG
    ZNF335 ENSG00000198026 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,245]
    ZNF337 ENSG00000130684 C2H2 ZF Known motif – High-throughput in vitro [1,246] AGTRGTGAYRAATTC
    ZNF33A ENSG00000189180 C2H2 ZF Known motif – High-throughput in vitro [1,247] TCAGTGCAC
    ZNF33B ENSG00000196693 C2H2 ZF Known motif – High-throughput in vitro [1,248] ATTMAATHCCHTYYNHTDVMW
    ZNF34 ENSG00000196378 C2H2 ZF Known motif – In vivo/Misc source [1,249] DRARGAVAAGYCTGD
    ZNF341 ENSG00000131061 C2H2 ZF Known motif – In vivo/Misc source [1,250] VVVRRVRRNDVVNGGARSAGC
    ZNF343 ENSG00000088876 C2H2 ZF Known motif – High-throughput in vitro [1,251] KRCCGHGGKGAAGCGB
    ZNF345 ENSG00000251247 C2H2 ZF Known motif – High-throughput in vitro [1,252] TTGCAACVYVNRCAACYGKAC
    ZNF346 ENSG00000113761 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,253]
    ZNF347 ENSG00000197937 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,254]
    ZNF35 ENSG00000169981 C2H2 ZF Known motif – High-throughput in vitro [1,255] ATATRTAAAGAGYTYYTABAA
    ZNF350 ENSG00000256683 C2H2 ZF Known motif – High-throughput in vitro [1,256] DNBDVRKHAWAAAARRRCH
    ZNF354A ENSG00000169131 C2H2 ZF Known motif – High-throughput in vitro [1,257] RTAAATGGHYTAAAY
    ZNF354B ENSG00000178338 C2H2 ZF Known motif – High-throughput in vitro [1,258] AAKGRRMTAWHY
    ZNF354C ENSG00000177932 C2H2 ZF Known motif – In vivo/Misc source [1,259] VTCCAC
    ZNF358 ENSG00000198816 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,260]
    ZNF362 ENSG00000160094 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,261]
    ZNF365 ENSG00000138311 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,262]
    ZNF366 ENSG00000178175 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,263]
    ZNF367 ENSG00000165244 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,264]
    ZNF37A ENSG00000075407 C2H2 ZF Known motif – High-throughput in vitro [1,265] GGARRRRRV
    ZNF382 ENSG00000161298 C2H2 ZF Known motif – High-throughput in vitro [1,266] GWGVMANYASTACAGRYMHHRBDS
    ZNF383 ENSG00000188283 C2H2 ZF Known motif – High-throughput in vitro [1,267] GAGSVRVRASRKGGMAGGRRBCNGGGY
    ZNF384 ENSG00000126746 C2H2 ZF Known motif – High-throughput in vitro [1,268] TTTTBNNNNNNNNNNNNVAAAA
    ZNF385A ENSG00000161642 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,269]
    ZNF385B ENSG00000144331 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,270]
    ZNF385C ENSG00000187595 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,271]
    ZNF385D ENSG00000151789 C2H2 ZF Known motif – High-throughput in vitro [1,272] HHGTCGCGACRD
    ZNF391 ENSG00000124613 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,273]
    ZNF394 ENSG00000160908 C2H2 ZF Known motif – In vivo/Misc source [1,274] VVRGGAGNAGCWGNRVVDNV
    ZNF395 ENSG00000186918 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,275]
    ZNF396 ENSG00000186496 C2H2 ZF Known motif – High-throughput in vitro [1,276] VTTTCGKACAB
    ZNF397 ENSG00000186812 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,277]
    ZNF398 ENSG00000197024 C2H2 ZF Known motif – In vivo/Misc source [1,278] DGGGARRGARRSAG
    ZNF404 ENSG00000176222 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,279]
    ZNF407 ENSG00000215421 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,280]
    ZNF408 ENSG00000175213 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,281]
    ZNF41 ENSG00000147124 C2H2 ZF Known motif – High-throughput in vitro [1,282] RMARGGRARNNNRRSACMATGAGNVAV
    ZNF410 ENSG00000119725 C2H2 ZF Known motif – High-throughput in vitro [1,283] MCATCCCATAATANBM
    ZNF414 ENSG00000133250 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,284]
    ZNF415 ENSG00000170954 C2H2 ZF Known motif – In vivo/Misc source [1,285] VTRCVCVMTKARBATC
    ZNF416 ENSG00000083817 C2H2 ZF Known motif – In vivo/Misc source [1,286] TRGCCCAGTCAAGTTGAC
    ZNF417 ENSG00000173480 C2H2 ZF Known motif – High-throughput in vitro [1,287] HNGGCGCCAVNTG
    ZNF418 ENSG00000196724 C2H2 ZF Known motif – High-throughput in vitro [1,288] VDGWRGCYAAAAGCA
    ZNF419 ENSG00000105136 C2H2 ZF Known motif – High-throughput in vitro [1,289] DGGARAGKMHAGGRCTGBADW
    ZNF420 ENSG00000197050 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,290]
    ZNF423 ENSG00000102935 C2H2 ZF Known motif – In vivo/Misc source [1,291] GRCACCCWAGGGTGC
    ZNF425 ENSG00000204947 C2H2 ZF Known motif – In vivo/Misc source [1,292] GGBACA
    ZNF426 ENSG00000130818 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,293]
    ZNF428 ENSG00000131116 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,294]
    ZNF429 ENSG00000197013 C2H2 ZF Known motif – High-throughput in vitro [1,295] DGGMRKAGSHVNMAATGGGYH
    ZNF43 ENSG00000198521 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,296]
    ZNF430 ENSG00000118620 C2H2 ZF Known motif – High-throughput in vitro [1,297] MCADGGHRGMNDGCHR
    ZNF431 ENSG00000196705 C2H2 ZF Known motif – In vivo/Misc source [1,298] VRGGCTRGMWGNYNV
    ZNF432 ENSG00000256087 C2H2 ZF Known motif – In vivo/Misc source [1,299] GTYRAAAACAAT
    ZNF433 ENSG00000197647 C2H2 ZF Known motif – High-throughput in vitro [1,300] RDGACYRHWGTRRTAAYY
    ZNF436 ENSG00000125945 C2H2 ZF Known motif – High-throughput in vitro [1,301] TCCTCCAGGAAGCCY
    ZNF438 ENSG00000183621 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,302]
    ZNF439 ENSG00000171291 C2H2 ZF Known motif – In vivo/Misc source [1,303] CARTCACCYYCHGGV
    ZNF44 ENSG00000197857 C2H2 ZF Known motif – High-throughput in vitro [1,304] VBGNTVYKGCHGYDVNG
    ZNF440 ENSG00000171295 C2H2 ZF Known motif – High-throughput in vitro [1,305] RRTKGTTCTGCW
    ZNF441 ENSG00000197044 C2H2 ZF Known motif – High-throughput in vitro [1,306] SRGRCGGAGYB
    ZNF442 ENSG00000198342 C2H2 ZF Known motif – In vivo/Misc source [1,307] SHWDWTWTTTNHHTTTTT
    ZNF443 ENSG00000180855 C2H2 ZF Known motif – High-throughput in vitro [1,308] GYCTBCYMAGWHGCKGGBRTT
    ZNF444 ENSG00000167685 C2H2 ZF Known motif – High-throughput in vitro [1,309] DGGGGGAGGGGGAYG
    ZNF445 ENSG00000185219 C2H2 ZF Known motif – In vivo/Misc source [1,310] AAMTYCYYGASNRNMMAGGRKTMYYYCHC
    ZNF446 ENSG00000083838 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,311]
    ZNF449 ENSG00000173275 C2H2 ZF Known motif – High-throughput in vitro [1,312] RCGCCCAACC
    ZNF45 ENSG00000124459 C2H2 ZF Known motif – High-throughput in vitro [1,313] AGGAANAYA
    ZNF451 ENSG00000112200 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,314]
    ZNF454 ENSG00000178187 C2H2 ZF Known motif – High-throughput in vitro [1,315] WRGCGCCWGGCGCYW
    ZNF460 ENSG00000197714 C2H2 ZF Known motif – High-throughput in vitro [1,316] CAACGCCCCCCG
    ZNF461 ENSG00000197808 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,317]
    ZNF462 ENSG00000148143 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,318]
    ZNF467 ENSG00000181444 C2H2 ZF Known motif – High-throughput in vitro [1,319] GGDGGGGGAGGG
    ZNF468 ENSG00000204604 C2H2 ZF Known motif – High-throughput in vitro [1,320] DGGGAGGGGGYGSNS
    ZNF469 ENSG00000225614 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,321]
    ZNF470 ENSG00000197016 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,322]
    ZNF471 ENSG00000196263 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,323]
    ZNF473 ENSG00000142528 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,324]
    ZNF474 ENSG00000164185 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,325]
    ZNF479 ENSG00000185177 C2H2 ZF Known motif – High-throughput in vitro [1,326] GADGACYYKGRGGRY
    ZNF48 ENSG00000180035 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,327]
    ZNF480 ENSG00000198464 C2H2 ZF Known motif – High-throughput in vitro [1,328] DRDGAAKGDGDD
    ZNF483 ENSG00000173258 C2H2 ZF Known motif – High-throughput in vitro [1,329] DSAGRGAGCTGCA
    ZNF484 ENSG00000127081 C2H2 ZF Known motif – High-throughput in vitro [1,330] VRDGGAVWGVRGMASWDGVNV
    ZNF485 ENSG00000198298 C2H2 ZF Known motif – High-throughput in vitro [1,331] AYTTSSWWTKKSRMYRTRKGS
    ZNF486 ENSG00000256229 C2H2 ZF Known motif – In vivo/Misc source [1,332] VVBBBNSNGCSGAMDCCCGGV
    ZNF487 ENSG00000243660 C2H2 ZF Known motif – In vivo/Misc source [1,333] VVBBBNSNGCSGAMDCCCGGV
    ZNF488 ENSG00000265763 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,334]
    ZNF490 ENSG00000188033 C2H2 ZF Known motif – In vivo/Misc source [1,335] HDGNMRGCAGCANAY
    ZNF491 ENSG00000177599 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,336]
    ZNF492 ENSG00000229676 C2H2 ZF Known motif – High-throughput in vitro [1,337] MNAARARMAMBAAAARGG
    ZNF493 ENSG00000196268 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,338]
    ZNF496 ENSG00000162714 C2H2 ZF Known motif – In vivo/Misc source [1,339] BCNSBCYCYBHMYYHSHBYCY
    ZNF497 ENSG00000174586 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,340]
    ZNF500 ENSG00000103199 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,341]
    ZNF501 ENSG00000186446 C2H2 ZF Known motif – High-throughput in vitro [1,342] GCGACGCGAMCV
    ZNF502 ENSG00000196653 C2H2 ZF Known motif – High-throughput in vitro [1,343] GGACYDBTGCAGTAGYHH
    ZNF503 ENSG00000165655 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,344]
    ZNF506 ENSG00000081665 C2H2 ZF Known motif – High-throughput in vitro [1,345] YTGGGGGCTCVBMC
    ZNF507 ENSG00000168813 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,346]
    ZNF510 ENSG00000081386 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,347]
    ZNF511 ENSG00000198546 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,348]
    ZNF512 ENSG00000243943 C2H2 ZF; BED ZF Likely sequence specific TF according to literature or domain structure – No motif [1,349]
    ZNF512B ENSG00000196700 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,350]
    ZNF513 ENSG00000163795 C2H2 ZF Known motif – High-throughput in vitro [1,351] GATGRTGATGATGRT
    ZNF514 ENSG00000144026 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,352]
    ZNF516 ENSG00000101493 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,353]
    ZNF517 ENSG00000197363 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,354]
    ZNF518A ENSG00000177853 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,355]
    ZNF518B ENSG00000178163 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,356]
    ZNF519 ENSG00000175322 C2H2 ZF Known motif – High-throughput in vitro [1,357] GGGCGGCKGCRGCBGCGS
    ZNF521 ENSG00000198795 C2H2 ZF Known motif – In vivo/Misc source [1,358] TGGGGGMCCCCW
    ZNF524 ENSG00000171443 C2H2 ZF; AT hook Known motif – High-throughput in vitro [1,359] YTCGVACCC
    ZNF525 ENSG00000203326 C2H2 ZF Known motif – High-throughput in vitro [1,360] RTTMCTWATDMAGNT
    ZNF526 ENSG00000167625 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,361]
    ZNF527 ENSG00000189164 C2H2 ZF Known motif – In vivo/Misc source [1,362] DGRKNGBMDGHRACAGMRR
    ZNF528 ENSG00000167555 C2H2 ZF Known motif – High-throughput in vitro [1,363] GGAAGYCATTTC
    ZNF529 ENSG00000186020 C2H2 ZF Known motif – In vivo/Misc source [1,364] CYCYBYCTBCYHDSM
    ZNF530 ENSG00000183647 C2H2 ZF Known motif – High-throughput in vitro [1,365] GMADGGMNAGGGSCNGVV
    ZNF532 ENSG00000074657 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,366]
    ZNF534 ENSG00000198633 C2H2 ZF Known motif – High-throughput in vitro [1,367] GVGGGGMRAGARBNBVV
    ZNF536 ENSG00000198597 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,368]
    ZNF540 ENSG00000171817 C2H2 ZF Known motif – In vivo/Misc source [1,369] RGRGGVAGGVA
    ZNF541 ENSG00000118156 C2H2 ZF; Myb/SANT Known motif – In vivo/Misc source [1,370] CCCATGCGCGGG
    ZNF543 ENSG00000178229 C2H2 ZF Known motif – High-throughput in vitro [1,371] SSVCWGGVCMGS
    ZNF544 ENSG00000198131 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,372]
    ZNF546 ENSG00000187187 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,373]
    ZNF547 ENSG00000152433 C2H2 ZF Known motif – High-throughput in vitro [1,374] GCWAAYKCWGCARGC
    ZNF548 ENSG00000188785 C2H2 ZF Known motif – High-throughput in vitro [1,375] GBBGCKGCDGSVSSVSVG
    ZNF549 ENSG00000121406 C2H2 ZF Known motif – High-throughput in vitro [1,376] ATGAAYYGGGCAGCM
    ZNF550 ENSG00000251369 C2H2 ZF Known motif – High-throughput in vitro [1,377] DNVRRDGCWRRGGYAGRG
    ZNF551 ENSG00000204519 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,378]
    ZNF552 ENSG00000178935 C2H2 ZF Known motif – High-throughput in vitro [1,379] CCACGAGGGGH
    ZNF554 ENSG00000172006 C2H2 ZF Known motif – High-throughput in vitro [1,380] CHGRGYCANNYRGDKDRCH
    ZNF555 ENSG00000186300 C2H2 ZF Known motif – In vivo/Misc source [1,381] AAAAAGCCGCGGCGG
    ZNF556 ENSG00000172000 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,382]
    ZNF557 ENSG00000130544 C2H2 ZF Known motif – In vivo/Misc source [1,383] MAGARTGYT
    ZNF558 ENSG00000167785 C2H2 ZF Known motif – High-throughput in vitro [1,384] HKGRAYHTGTRGRTKBATRYCTTYCAK
    ZNF559 ENSG00000188321 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,385]
    ZNF560 ENSG00000198028 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,386]
    ZNF561 ENSG00000171469 C2H2 ZF Known motif – In vivo/Misc source [1,387] DSNGCMGAAARGSBBYBBBCC
    ZNF562 ENSG00000171466 C2H2 ZF Known motif – In vivo/Misc source [1,388] DDYYCAGCAAGGCAMWWT
    ZNF563 ENSG00000188868 C2H2 ZF Known motif – High-throughput in vitro [1,389] BTCMBNNSHRGCMRCHGY
    ZNF564 ENSG00000249709 C2H2 ZF Known motif – High-throughput in vitro [1,390] GGGAAGTCCAAG
    ZNF565 ENSG00000196357 C2H2 ZF Known motif – High-throughput in vitro [1,391] ATGYTGTGAGGAAGCYCA
    ZNF566 ENSG00000186017 C2H2 ZF Known motif – High-throughput in vitro [1,392] VNDGCKGVAARGGARSC
    ZNF567 ENSG00000189042 C2H2 ZF Known motif – High-throughput in vitro [1,393] VHAVAARHAGAMMHHNARRTG
    ZNF568 ENSG00000198453 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,394]
    ZNF569 ENSG00000196437 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,395]
    ZNF57 ENSG00000171970 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,396]
    ZNF570 ENSG00000171827 C2H2 ZF Known motif – High-throughput in vitro [1,397] ARAHAWMWHNMAAGAAAA
    ZNF571 ENSG00000180479 C2H2 ZF Known motif – High-throughput in vitro [1,398] SSGMGGCBGMGGCRG
    ZNF572 ENSG00000180938 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,399]
    ZNF573 ENSG00000189144 C2H2 ZF Known motif – High-throughput in vitro [1,400] MAGHMMDGGCMCAMNMADB
    ZNF574 ENSG00000105732 C2H2 ZF Known motif – High-throughput in vitro [1,401] CTAGAGMGKCSS
    ZNF575 ENSG00000176472 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,402]
    ZNF576 ENSG00000124444 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,403]
    ZNF577 ENSG00000161551 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,404]
    ZNF578 ENSG00000258405 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,405]
    ZNF579 ENSG00000218891 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,406]
    ZNF580 ENSG00000213015 C2H2 ZF Known motif – High-throughput in vitro [1,407] VCTACCNYHNNVCTACCNH
    ZNF581 ENSG00000171425 C2H2 ZF Known motif – In vivo/Misc source [1,408] CTTCTAVAAGV
    ZNF582 ENSG00000018869 C2H2 ZF Known motif – High-throughput in vitro [1,409] KYMSYTGCMGCCNARNGCAYBCYH
    ZNF583 ENSG00000198440 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,410]
    ZNF584 ENSG00000171574 C2H2 ZF Known motif – High-throughput in vitro [1,411] DNTTTMARAAHTGYTWTGGDH
    ZNF585A ENSG00000196967 C2H2 ZF Known motif – High-throughput in vitro [1,412] TCYGTWYTY
    ZNF585B ENSG00000245680 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,413]
    ZNF586 ENSG00000083828 C2H2 ZF Known motif – High-throughput in vitro [1,414] CAGGCCYRGAGG
    ZNF587 ENSG00000198466 C2H2 ZF Known motif – High-throughput in vitro [1,415] MCMRYGTTGGGCGCHANNHD
    ZNF587B ENSG00000269343 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,416]
    ZNF589 ENSG00000164048 C2H2 ZF Known motif – In vivo/Misc source [1,417] VSRBDRWWVCCBYKK
    ZNF592 ENSG00000166716 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,418]
    ZNF594 ENSG00000180626 C2H2 ZF Known motif – High-throughput in vitro [1,419] RDDSDGAGAGCNSS
    ZNF595 ENSG00000272602 C2H2 ZF Known motif – High-throughput in vitro [1,420] GGGAGGGMWKC
    ZNF596 ENSG00000172748 C2H2 ZF Known motif – High-throughput in vitro [1,421] VGVRRGAGVSMGAGM
    ZNF597 ENSG00000167981 C2H2 ZF Known motif – High-throughput in vitro [1,422] CAARATGGCGKM
    ZNF598 ENSG00000167962 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,423]
    ZNF599 ENSG00000153896 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,424]
    ZNF600 ENSG00000189190 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,425]
    ZNF605 ENSG00000196458 C2H2 ZF Known motif – High-throughput in vitro [1,426] DGGKNNDDAGRVVCCMNRVD
    ZNF606 ENSG00000166704 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,427]
    ZNF607 ENSG00000198182 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,428]
    ZNF608 ENSG00000168916 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,429]
    ZNF609 ENSG00000180357 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,430]
    ZNF610 ENSG00000167554 C2H2 ZF Known motif – High-throughput in vitro [1,431] GGAGCGGC
    ZNF611 ENSG00000213020 C2H2 ZF Known motif – High-throughput in vitro [1,432] GGAGMGCCBVNGVVBVSCBSB
    ZNF613 ENSG00000176024 C2H2 ZF Known motif – High-throughput in vitro [1,433] WAAAAAAAB
    ZNF614 ENSG00000142556 C2H2 ZF Known motif – In vivo/Misc source [1,434] BDCTTKAKCTMATKD
    ZNF615 ENSG00000197619 C2H2 ZF Known motif – High-throughput in vitro [1,435] AAABDVCTGYBSCCC
    ZNF616 ENSG00000204611 C2H2 ZF Known motif – High-throughput in vitro [1,436] RHRGGTGAGCRY
    ZNF618 ENSG00000157657 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,437]
    ZNF619 ENSG00000177873 C2H2 ZF Known motif – In vivo/Misc source [1,438] BYNNBCCCCNNCCYCAGGAAT
    ZNF620 ENSG00000177842 C2H2 ZF Known motif – In vivo/Misc source [1,439] WKTSYAKTY
    ZNF621 ENSG00000172888 C2H2 ZF Known motif – In vivo/Misc source [1,440] RRRVKCYCAGGGMAG
    ZNF623 ENSG00000183309 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,441]
    ZNF624 ENSG00000197566 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,442]
    ZNF625 ENSG00000257591 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,443]
    ZNF626 ENSG00000188171 C2H2 ZF Known motif – High-throughput in vitro [1,444] HDVRTNNKGYTVHKVTGBYCCYTSYH
    ZNF627 ENSG00000198551 C2H2 ZF Known motif – High-throughput in vitro [1,445] TTTAAGCCCACTGTTGAG
    ZNF628 ENSG00000197483 C2H2 ZF Known motif – In vivo/Misc source [1,446] GCAACCAACCTTG
    ZNF629 ENSG00000102870 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,447]
    ZNF630 ENSG00000221994 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,448]
    ZNF639 ENSG00000121864 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,449]
    ZNF641 ENSG00000167528 C2H2 ZF Known motif – High-throughput in vitro [1,450] TGGGGGGGT
    ZNF644 ENSG00000122482 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,451]
    ZNF645 ENSG00000175809 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,452]
    ZNF646 ENSG00000167395 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,453]
    ZNF648 ENSG00000179930 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,454]
    ZNF649 ENSG00000198093 C2H2 ZF Known motif – High-throughput in vitro [1,455] ATATAA
    ZNF652 ENSG00000198740 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [1,456]
    ZNF653 ENSG00000161914 C2H2 ZF; AT hook Known motif – In vivo/Misc source [1,457] WTTHNYDHCYKCCGACWNHWAWD
    ZNF654 ENSG00000175105 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,458]
    ZNF655 ENSG00000197343 C2H2 ZF Known motif – High-throughput in vitro [1,459] RVTAH
    ZNF658 ENSG00000274349 C2H2 ZF Known motif – In vivo/Misc source [1,460] GGGGTRGGACGAGGTGGG
    ZNF66 ENSG00000160229 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,461]
    ZNF660 ENSG00000144792 C2H2 ZF Known motif – High-throughput in vitro [1,462] DYAGGDTGGRBHATCADB
    ZNF662 ENSG00000182983 C2H2 ZF Known motif – High-throughput in vitro [1,463] DRNAGSMVVGKGMYAGMB
    ZNF664 ENSG00000179195 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,464] GTTBAAWMCGC
    ZNF665 ENSG00000197497 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,465]
    ZNF667 ENSG00000198046 C2H2 ZF Known motif – High-throughput in vitro [1,466] GCYTTAARAGCTCANCH
    ZNF668 ENSG00000167394 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,467]
    ZNF669 ENSG00000188295 C2H2 ZF Known motif – High-throughput in vitro [1,468] VNHHRSANYGGTCRTCRNCCH
    ZNF670 ENSG00000277462 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,469]
    ZNF671 ENSG00000083814 C2H2 ZF Known motif – High-throughput in vitro [1,470] GAKTGGADBRV
    ZNF672 ENSG00000171161 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,471]
    ZNF674 ENSG00000251192 C2H2 ZF Known motif – High-throughput in vitro [1,472] GGRBCVCCRVV
    ZNF675 ENSG00000197372 C2H2 ZF Known motif – High-throughput in vitro [1,473] RKGVNHNRGRGGMYAAAAYGD
    ZNF676 ENSG00000196109 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,474]
    ZNF677 ENSG00000197928 C2H2 ZF Known motif – High-throughput in vitro [1,475] GRAMMCHRAHAAGAWCAGHH
    ZNF678 ENSG00000181450 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,476]
    ZNF679 ENSG00000197123 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,477] DGGCAGCAGM
    ZNF680 ENSG00000173041 C2H2 ZF Known motif – High-throughput in vitro [1,478] HNNNNDGNCMAAGAAGAHTNW
    ZNF681 ENSG00000196172 C2H2 ZF Known motif – High-throughput in vitro [1,479] VAAGGABGVNGR
    ZNF682 ENSG00000197124 C2H2 ZF Known motif – High-throughput in vitro [1,480] DDHYMAGCCC
    ZNF683 ENSG00000176083 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,481]
    ZNF684 ENSG00000117010 C2H2 ZF Known motif – High-throughput in vitro [1,482] BACAGTCCACCCCTTDV
    ZNF687 ENSG00000143373 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,483]
    ZNF688 ENSG00000229809 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,484]
    ZNF689 ENSG00000156853 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,485]
    ZNF69 ENSG00000198429 C2H2 ZF Known motif – In vivo/Misc source [1,486] GGRGSHGGGGBDGGV
    ZNF691 ENSG00000164011 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [1,487] RKGAGYAC
    ZNF692 ENSG00000171163 C2H2 ZF Known motif – In vivo/Misc source [1,488] SBGGGVCCCACH
    ZNF695 ENSG00000197472 C2H2 ZF Known motif – In vivo/Misc source [1,489] ACCAMMHMC
    ZNF696 ENSG00000185730 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,490]
    ZNF697 ENSG00000143067 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,491] KKKGCGAGGGM
    ZNF699 ENSG00000196110 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,492]
    ZNF7 ENSG00000147789 C2H2 ZF Known motif – High-throughput in vitro [1,493] VWRRMADYWNYAARWGBWGRC
    ZNF70 ENSG00000187792 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,494]
    ZNF700 ENSG00000196757 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,495]
    ZNF701 ENSG00000167562 C2H2 ZF Known motif – High-throughput in vitro [1,496] GAGMASYHDRGG
    ZNF703 ENSG00000183779 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,497]
    ZNF704 ENSG00000164684 C2H2 ZF Known motif – High-throughput in vitro [1,498] HRCCGGCCGGYD
    ZNF705A ENSG00000196946 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,499] CCAAAARAAYY
    ZNF705B ENSG00000215356 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,500] CCAAAARAAYY
    ZNF705D ENSG00000215343 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,501] CCAAAARAAYY
    ZNF705E ENSG00000214534 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,502]
    ZNF705G ENSG00000215372 C2H2 ZF Known motif – In vivo/Misc source [1,503] RAKAAACCTCY
    ZNF706 ENSG00000120963 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,504]
    ZNF707 ENSG00000181135 C2H2 ZF Known motif – High-throughput in vitro [1,505] DACMAGGAGTGGGGTK
    ZNF708 ENSG00000182141 C2H2 ZF Known motif – High-throughput in vitro [1,506] RDDAGGYACAGCH
    ZNF709 ENSG00000242852 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,507]
    ZNF71 ENSG00000197951 C2H2 ZF Known motif – High-throughput in vitro [1,508] BRGNRGSMRRRGVRARRARRGMAA
    ZNF710 ENSG00000140548 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,509]
    ZNF711 ENSG00000147180 C2H2 ZF Known motif – In vivo/Misc source [1,510] MGGCCTVS
    ZNF713 ENSG00000178665 C2H2 ZF Known motif – High-throughput in vitro [1,511] WAGAMRAAWGCCACGAA
    ZNF714 ENSG00000160352 C2H2 ZF Known motif – High-throughput in vitro [1,512] DKMRKTSCTGCT
    ZNF716 ENSG00000182111 C2H2 ZF Known motif – High-throughput in vitro [1,513] VTATTTCY
    ZNF717 ENSG00000227124 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,514]
    ZNF718 ENSG00000250312 C2H2 ZF Known motif – In vivo/Misc source [1,515] GGGRATWGCGM
    ZNF721 ENSG00000182903 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,516]
    ZNF724 ENSG00000196081 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,517]
    ZNF726 ENSG00000213967 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,518]
    ZNF727 ENSG00000214652 C2H2 ZF Known motif – In vivo/Misc source [1,519] GGTCCAAWTGM
    ZNF728 ENSG00000269067 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,520]
    ZNF729 ENSG00000196350 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,521]
    ZNF730 ENSG00000183850 C2H2 ZF Known motif – High-throughput in vitro [1,522] GGGMRGSBRNGG
    ZNF732 ENSG00000186777 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,523]
    ZNF735 ENSG00000223614 C2H2 ZF Known motif – In vivo/Misc source [1,524] DGGCAGCAGM
    ZNF736 ENSG00000234444 C2H2 ZF Known motif – High-throughput in vitro [1,525] YCYRGGGYTTTT
    ZNF737 ENSG00000237440 C2H2 ZF Known motif – In vivo/Misc source [1,526] RKRVDGRDGVWGGDG
    ZNF74 ENSG00000185252 C2H2 ZF Known motif – In vivo/Misc source [1,527] RAAGATGTTCHYYDCVKYRTTRTTTAHVW
    ZNF740 ENSG00000139651 C2H2 ZF Known motif – High-throughput in vitro [1,528] YNCCCCCCCCAC
    ZNF746 ENSG00000181220 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,529]
    ZNF747 ENSG00000169955 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,530]
    ZNF749 ENSG00000186230 C2H2 ZF Known motif – High-throughput in vitro [1,531] GYTGGGGYT
    ZNF750 ENSG00000141579 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,532]
    ZNF75A ENSG00000162086 C2H2 ZF Known motif – High-throughput in vitro [1,533] TGTGGGAAAASM
    ZNF75D ENSG00000186376 C2H2 ZF Known motif – High-throughput in vitro [1,534] GTGGGAAAKCCTTYH
    ZNF76 ENSG00000065029 C2H2 ZF Known motif – High-throughput in vitro [1,535] HWCCCABAATGCAHYRCR
    ZNF761 ENSG00000160336 C2H2 ZF Known motif – In vivo/Misc source [1,536] KGDWAATCAKA
    ZNF763 ENSG00000197054 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,537]
    ZNF764 ENSG00000169951 C2H2 ZF Known motif – In vivo/Misc source [1,538] TGCARCCYAGCTCTAYDAGMC
    ZNF765 ENSG00000196417 C2H2 ZF Known motif – High-throughput in vitro [1,539] CTBGGCHVNGCMCWGVS
    ZNF766 ENSG00000196214 C2H2 ZF Known motif – In vivo/Misc source [1,540] RAKAAACCYYH
    ZNF768 ENSG00000169957 C2H2 ZF Known motif – High-throughput in vitro [1,541] CHCAGAGAGGKYRAG
    ZNF77 ENSG00000175691 C2H2 ZF Known motif – In vivo/Misc source [1,542] TYMYCACTYCACYHNNNHMAD
    ZNF770 ENSG00000198146 C2H2 ZF Known motif – In vivo/Misc source [1,543] GGAGGCYGVVV
    ZNF771 ENSG00000179965 C2H2 ZF Known motif – High-throughput in vitro [1,544] RCGCTAACCAYTD
    ZNF772 ENSG00000197128 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,545]
    ZNF773 ENSG00000152439 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,546]
    ZNF774 ENSG00000196391 C2H2 ZF Known motif – High-throughput in vitro [1,547] DGRRRVRGAGVHDGRRD
    ZNF775 ENSG00000196456 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,548]
    ZNF776 ENSG00000152443 C2H2 ZF Known motif – High-throughput in vitro [1,549] GAAGCAHRRYGCYGGCATCTG
    ZNF777 ENSG00000196453 C2H2 ZF Known motif – In vivo/Misc source [1,550] GHCCSYCCCGTCSARCAAW
    ZNF778 ENSG00000170100 C2H2 ZF Known motif – High-throughput in vitro [1,551] CAGACRMCRRCH
    ZNF780A ENSG00000197782 C2H2 ZF Known motif – High-throughput in vitro [1,552] VNNNNDNNHDGGCAGGYNBNYDDV
    ZNF780B ENSG00000128000 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,553]
    ZNF781 ENSG00000196381 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,554]
    ZNF782 ENSG00000196597 C2H2 ZF Known motif – In vivo/Misc source [1,555] HARRHCCWACAHVDRGRSHNYCTCAVRVVY
    ZNF783 ENSG00000204946 C2H2 ZF Known motif – In vivo/Misc source [1,556] SBTSCWSCDSCDSYDSCWGCT
    ZNF784 ENSG00000179922 C2H2 ZF Known motif – High-throughput in vitro [1,557] ACYTWCCK
    ZNF785 ENSG00000197162 C2H2 ZF Known motif – In vivo/Misc source [1,558] ACWBRBRCAYACASWYVMMCVMACACASA
    ZNF786 ENSG00000197362 C2H2 ZF Known motif – In vivo/Misc source [1,559] CRGRGNCCCRRRGRC
    ZNF787 ENSG00000142409 C2H2 ZF Known motif – High-throughput in vitro [1,560] BGAGGCANNNNNNNTGCATY
    ZNF788 ENSG00000214189 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,561]
    ZNF789 ENSG00000198556 C2H2 ZF Known motif – High-throughput in vitro [1,562] CYYSTGACACCH
    ZNF79 ENSG00000196152 C2H2 ZF Known motif – High-throughput in vitro [1,563] AAAVRAAWDAATNTCTAA
    ZNF790 ENSG00000197863 C2H2 ZF Known motif – High-throughput in vitro [1,564] GTGCAGCA
    ZNF791 ENSG00000173875 C2H2 ZF Known motif – In vivo/Misc source [1,565] CKCTGACCCCDCCTCCYBTCTAAA
    ZNF792 ENSG00000180884 C2H2 ZF Known motif – In vivo/Misc source [1,566] DRCTGDTKWNHDBAGATAGKR
    ZNF793 ENSG00000188227 C2H2 ZF Known motif – High-throughput in vitro [1,567] GARCCCCAAGVV
    ZNF799 ENSG00000196466 C2H2 ZF Known motif – High-throughput in vitro [1,568] AYMCYBGYTGTCTCAGTGWTTKGS
    ZNF8 ENSG00000278129 C2H2 ZF Known motif – High-throughput in vitro [1,569] DHNDDGRCRTACCRBV
    ZNF80 ENSG00000174255 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,570]
    ZNF800 ENSG00000048405 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,571]
    ZNF804A ENSG00000170396 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,572]
    ZNF804B ENSG00000182348 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,573]
    ZNF805 ENSG00000204524 C2H2 ZF Known motif – High-throughput in vitro [1,574] MYKSCATTCCWTKSCWTKYSR
    ZNF808 ENSG00000198482 C2H2 ZF Known motif – High-throughput in vitro [1,575] GGNWGGWCTVYAAAVNVSHYKBTHNDKND
    ZNF81 ENSG00000197779 C2H2 ZF Known motif – High-throughput in vitro [1,576] TGGTVNHACYABYNNRRA
    ZNF813 ENSG00000198346 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,577]
    ZNF814 ENSG00000204514 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,578]
    ZNF816 ENSG00000180257 C2H2 ZF Known motif – High-throughput in vitro [1,579] VVNNRDGGGGACMKGHND
    ZNF821 ENSG00000102984 C2H2 ZF Known motif – High-throughput in vitro [1,580] HRGACAGACVGACR
    ZNF823 ENSG00000197933 C2H2 ZF Known motif – High-throughput in vitro [1,581] HHYTTCTCYNYYBCY
    ZNF827 ENSG00000151612 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,582]
    ZNF829 ENSG00000185869 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,583]
    ZNF83 ENSG00000167766 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,584]
    ZNF830 ENSG00000198783 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,585]
    ZNF831 ENSG00000124203 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,586]
    ZNF835 ENSG00000127903 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,587]
    ZNF836 ENSG00000196267 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,588]
    ZNF837 ENSG00000152475 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,589]
    ZNF84 ENSG00000198040 C2H2 ZF Known motif – High-throughput in vitro [1,590] RVRRVNNVNRDGAACAGGMAR
    ZNF841 ENSG00000197608 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,591]
    ZNF843 ENSG00000176723 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,592]
    ZNF844 ENSG00000223547 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,593]
    ZNF845 ENSG00000213799 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,594]
    ZNF846 ENSG00000196605 C2H2 ZF Known motif – In vivo/Misc source [1,595] GVGSMVGGGMSVSVG
    ZNF85 ENSG00000105750 C2H2 ZF Known motif – High-throughput in vitro [1,596] BRGATTMCWKCA
    ZNF850 ENSG00000267041 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,597]
    ZNF852 ENSG00000178917 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [1,598] VYAHACTKTNRAGYGV
    ZNF853 ENSG00000236609 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,599]
    ZNF860 ENSG00000197385 C2H2 ZF Known motif – High-throughput in vitro [1,600] VRCAGGGAGCVRVVS
    ZNF865 ENSG00000261221 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,601]
    ZNF878 ENSG00000257446 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,602]
    ZNF879 ENSG00000234284 C2H2 ZF Known motif – High-throughput in vitro [1,603] AHARHAMWAHWRAAMMWANWWRVH
    ZNF880 ENSG00000221923 C2H2 ZF Known motif – High-throughput in vitro [1,604] DDNDDVDNGGGRRDGGGARAGDGMAR
    ZNF883 ENSG00000228623 C2H2 ZF Known motif – In vivo/Misc source [1,605] GAGGCAGCCACH
    ZNF888 ENSG00000213793 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,606]
    ZNF891 ENSG00000214029 C2H2 ZF Known motif – High-throughput in vitro [1,607] BNNNNSNGRCWKCYAGCC
    ZNF90 ENSG00000213988 C2H2 ZF Known motif – High-throughput in vitro [1,608] TGGGTGDRTMAKCAG
    ZNF91 ENSG00000167232 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,609]
    ZNF92 ENSG00000146757 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,610]
    ZNF93 ENSG00000184635 C2H2 ZF Known motif – High-throughput in vitro [1,611] BNNNBNHNGCWGCHRBSNYWGCTRCYDYC
    ZNF98 ENSG00000197360 C2H2 ZF Known motif – High-throughput in vitro [1,612] VNADRKMCAANAAAAAGGHM
    ZNF99 ENSG00000213973 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,613]
    ZSCAN1 ENSG00000152467 C2H2 ZF Known motif – High-throughput in vitro [1,614] HRCACACVCTGHMAVH
    ZSCAN10 ENSG00000130182 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [1,615] GDRAGTGC
    ZSCAN12 ENSG00000158691 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,616]
    ZSCAN16 ENSG00000196812 C2H2 ZF Known motif – High-throughput in vitro [1,617] GAGGCTCTGTTAACANY
    ZSCAN18 ENSG00000121413 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,618]
    ZSCAN2 ENSG00000176371 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,619]
    ZSCAN20 ENSG00000121903 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,620]
    ZSCAN21 ENSG00000166529 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,621]
    ZSCAN22 ENSG00000182318 C2H2 ZF Known motif – High-throughput in vitro [1,622] GNCHGABGGMGGAGGCNV
    ZSCAN23 ENSG00000187987 C2H2 ZF Known motif – High-throughput in vitro [1,623] BTGTAATTAGCACATGR
    ZSCAN25 ENSG00000197037 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,624]
    ZSCAN26 ENSG00000197062 C2H2 ZF Known motif – In vivo/Misc source [1,625] TGGGGGGCATM
    ZSCAN29 ENSG00000140265 C2H2 ZF Known motif – High-throughput in vitro [1,626] MCGYRTARMCGKCTAYRC
    ZSCAN30 ENSG00000186814 C2H2 ZF Known motif – High-throughput in vitro [1,627] BCCWGSRGCCHBSVS
    ZSCAN31 ENSG00000235109 C2H2 ZF Known motif – High-throughput in vitro [1,628] GHHGCAGGGCARTTATGC
    ZSCAN32 ENSG00000140987 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,629]
    ZSCAN4 ENSG00000180532 C2H2 ZF Known motif – High-throughput in vitro [1,630] HGCACACVCTGNMA
    ZSCAN5A ENSG00000131848 C2H2 ZF Known motif – High-throughput in vitro [1,631] HKTCCCYVCVCAAADM
    ZSCAN5B ENSG00000197213 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,632]
    ZSCAN5C ENSG00000204532 C2H2 ZF Known motif – High-throughput in vitro [1,633] GTGAGTNHAYRRRNV
    ZSCAN9 ENSG00000137185 C2H2 ZF Known motif – High-throughput in vitro [1,634] DRKGATAAGATAAGAABCM
    ZUFSP ENSG00000153975 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,635]
    ZXDA ENSG00000198205 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,636]
    ZXDB ENSG00000198455 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,637]
    ZXDC ENSG00000070476 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,638]
    ZZZ3 ENSG00000036549 Myb/SANT Known motif – High-throughput in vitro [1,639] SAATCCAW

    Новое сообщение