Мы используем файлы cookie.
Продолжая использовать сайт, вы даете свое согласие на работу с этими файлами.

Opioid peptide

Подписчиков: 0, рейтинг: 0

Vertebrate endogenous opioids neuropeptide
Identifiers
Symbol Opiods_neuropep
Pfam PF01160
InterPro IPR006024
PROSITE PDOC00964
Available protein structures:
Pfam   structures / ECOD  
PDB RCSB PDB; PDBe; PDBj
PDBsum structure summary
Structural correlation between met-enkephalin, an opioid peptide, (left) and morphine, an opiate drug, (right)

Opioid peptides or opiate peptides are peptides that bind to opioid receptors in the brain; opiates and opioids mimic the effect of these peptides. Such peptides may be produced by the body itself, for example endorphins. The effects of these peptides vary, but they all resemble those of opiates. Brain opioid peptide systems are known to play an important role in motivation, emotion, attachment behaviour, the response to stress and pain, control of food intake, and the rewarding effects of alcohol and nicotine.

Opioid-like peptides may also be absorbed from partially digested food (casomorphins, exorphins, and rubiscolins). Opioid peptides from food typically have lengths between 4–8 amino acids. Endogenous opioids are generally much longer.

Opioid peptides are released by post-translational proteolytic cleavage of precursor proteins. The precursors consist of the following components: a signal sequence that precedes a conserved region of about 50 residues; a variable-length region; and the sequence of the neuropeptides themselves. Sequence analysis reveals that the conserved N-terminal region of the precursors contains 6 cysteines, which are probably involved in disulfide bond formation. It is speculated that this region might be important for neuropeptide processing.

Endogenous

The human genome contains several homologous genes that are known to code for endogenous opioid peptides.

While not peptides, codeine and morphine are also produced in the human body.

Endogenous opioid peptides and their receptors
Opioid peptide Amino acid sequence Opioid receptor target(s) References
Enkephalins
Leu-enkephalin YGGFL δ-opioid receptor, μ-opioid receptor
Met-enkephalin YGGFM δ-opioid receptor, μ-opioid receptor
Metorphamide YGGFMRRV-NH2 δ-opioid receptor, μ-opioid receptor
Peptide E YGGFMRRVGRPEWWMDYQKRYGGFL μ-opioid receptor, κ-opioid receptor
Endorphins
α-Endorphin YGGFMTSEKSQTPLVT μ-opioid receptor, unknown affinity for other opioid receptors
β-Endorphin YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE μ-opioid receptor†‡, δ-opioid receptor
γ-Endorphin YGGFMTSEKSQTPLVTL μ-opioid receptor, unknown affinity for other opioid receptors
Dynorphins
Dynorphin A YGGFLRRIRPKLKWDNQ κ-opioid receptor†‡
Dynorphin A1–8 YGGFLRRI κ-opioid receptor, μ-opioid receptor (partial agonist at δ-opioid receptor)
Dynorphin B YGGFLRRQFKVVT κ-opioid receptor
Big dynorphin YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT κ-opioid receptor†‡
Leumorphin YGGFLRRQFKVVTRSQEDPNAYYEELFDV κ-opioid receptor
α-Neoendorphin YGGFLRKYPK κ-opioid receptor
β-Neoendorphin YGGFLRKYP κ-opioid receptor
Nociceptin
Nociceptin FGGFTGARKSARKLANQ nociceptin receptor†‡
Endomorphins
Endomorphin-1 YPWF-NH2 μ-opioid receptor
Endomorphin-2 YPFF-NH2 μ-opioid receptor
This symbol next to a receptor indicates that the corresponding peptide is a principal endogenous agonist of the receptor in humans.
This symbol next to a receptor indicates that the corresponding peptide is the endogenous ligand with the highest known potency for the receptor in humans.

Exogenous

Exogenous opioid substances are called exorphins, as opposed to endorphines. Exorphins include opioid food peptides like Gluten exorphin and opioid food peptides and are mostly contained in cereals and animal milk. Exorphins mimic the actions of endorphines by binding to an activating opioid receptors in the brain.

Common exorphins include:

Amphibian

Synthetic

External links

This article incorporates text from the public domain Pfam and InterPro: IPR006024

Новое сообщение